BLASTX nr result
ID: Akebia25_contig00056506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00056506 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22269.3| unnamed protein product [Vitis vinifera] 99 5e-19 ref|XP_002278886.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 ref|XP_003530418.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 ref|XP_003552546.1| PREDICTED: pentatricopeptide repeat-containi... 96 5e-18 ref|XP_002305377.2| hypothetical protein POPTR_0004s12430g [Popu... 94 3e-17 ref|XP_002532904.1| pentatricopeptide repeat-containing protein,... 92 6e-17 ref|XP_004491917.1| PREDICTED: pentatricopeptide repeat-containi... 89 5e-16 ref|XP_007139556.1| hypothetical protein PHAVU_008G039700g [Phas... 88 1e-15 ref|XP_004306116.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 gb|EXB38041.1| hypothetical protein L484_020960 [Morus notabilis] 87 3e-15 dbj|BAJ89066.1| predicted protein [Hordeum vulgare subsp. vulgare] 84 2e-14 ref|XP_006664140.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_003621319.1| Pentatricopeptide repeat-containing protein ... 84 2e-14 ref|XP_006338411.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_007217279.1| hypothetical protein PRUPE_ppa017633mg [Prun... 84 3e-14 ref|XP_002444640.1| hypothetical protein SORBIDRAFT_07g025280 [S... 83 3e-14 ref|XP_004232191.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_007032637.1| Tetratricopeptide repeat (TPR)-like superfam... 82 8e-14 ref|XP_004962988.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 tpg|DAA48352.1| TPA: hypothetical protein ZEAMMB73_382586 [Zea m... 81 1e-13 >emb|CBI22269.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 99.4 bits (246), Expect = 5e-19 Identities = 46/64 (71%), Positives = 53/64 (82%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG WDNFA +RLRMK+T+IQK G S IEVDDEVHEFTV DRSHP+S RIYK ID LGQH Sbjct: 442 AGDWDNFANIRLRMKSTSIQKPSGGSSIEVDDEVHEFTVFDRSHPKSDRIYKTIDGLGQH 501 Query: 72 LKQV 61 + ++ Sbjct: 502 INKL 505 >ref|XP_002278886.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Vitis vinifera] Length = 594 Score = 99.4 bits (246), Expect = 5e-19 Identities = 46/64 (71%), Positives = 53/64 (82%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG WDNFA +RLRMK+T+IQK G S IEVDDEVHEFTV DRSHP+S RIYK ID LGQH Sbjct: 527 AGDWDNFANIRLRMKSTSIQKPSGGSSIEVDDEVHEFTVFDRSHPKSDRIYKTIDGLGQH 586 Query: 72 LKQV 61 + ++ Sbjct: 587 INKL 590 >ref|XP_003530418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 604 Score = 96.3 bits (238), Expect = 4e-18 Identities = 48/71 (67%), Positives = 54/71 (76%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W N A VRL+M NT QK GAS IEV++EVHEFTV D+SHP+S IYKMIDRL Q Sbjct: 533 AGDWMNVANVRLQMMNTGGQKPSGASSIEVEEEVHEFTVFDQSHPKSDDIYKMIDRLVQD 592 Query: 72 LKQVGYVPRAH 40 L+QVGYVP H Sbjct: 593 LRQVGYVPMIH 603 >ref|XP_003552546.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 604 Score = 95.9 bits (237), Expect = 5e-18 Identities = 47/71 (66%), Positives = 55/71 (77%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W N A VRL+MKNT +K GAS IEV++EVHEFTV D+SHP+S IY+MIDRL Q Sbjct: 533 AGDWMNVANVRLQMKNTGGEKPSGASSIEVEEEVHEFTVFDQSHPKSDDIYQMIDRLVQD 592 Query: 72 LKQVGYVPRAH 40 L+QVGYVP H Sbjct: 593 LRQVGYVPMIH 603 >ref|XP_002305377.2| hypothetical protein POPTR_0004s12430g [Populus trichocarpa] gi|550340897|gb|EEE85888.2| hypothetical protein POPTR_0004s12430g [Populus trichocarpa] Length = 604 Score = 93.6 bits (231), Expect = 3e-17 Identities = 45/72 (62%), Positives = 56/72 (77%) Frame = -3 Query: 255 TAGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQ 76 +AG W + A VRL+MKN IQK GAS IEVDDEVHEFTV D+SHP+S +IY+MI+RLG Sbjct: 532 SAGDWSSVANVRLQMKNFGIQKPSGASSIEVDDEVHEFTVFDKSHPKSDKIYQMINRLGL 591 Query: 75 HLKQVGYVPRAH 40 LK+V VP+ + Sbjct: 592 DLKRVHVVPKVY 603 >ref|XP_002532904.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527338|gb|EEF29484.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 604 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/70 (58%), Positives = 56/70 (80%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W++ A +RL+MK+T +QK GAS IE+DDEVHEFTV D+SHP++ +IY+++ +LGQ Sbjct: 533 AGDWNSVANMRLQMKSTGVQKPSGASSIELDDEVHEFTVFDKSHPETDKIYQILVKLGQD 592 Query: 72 LKQVGYVPRA 43 LKQV Y P A Sbjct: 593 LKQVAYAPEA 602 >ref|XP_004491917.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cicer arietinum] Length = 321 Score = 89.4 bits (220), Expect = 5e-16 Identities = 44/68 (64%), Positives = 52/68 (76%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W N + VRL+MKN QK G S IEV++EVH+FTV D+SHP+SS IY MIDRL Q Sbjct: 174 AGDWINVSNVRLQMKNQGGQKPSGVSSIEVEEEVHKFTVLDQSHPKSSDIYNMIDRLVQA 233 Query: 72 LKQVGYVP 49 L+QVGYVP Sbjct: 234 LRQVGYVP 241 >ref|XP_007139556.1| hypothetical protein PHAVU_008G039700g [Phaseolus vulgaris] gi|561012689|gb|ESW11550.1| hypothetical protein PHAVU_008G039700g [Phaseolus vulgaris] Length = 604 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/68 (63%), Positives = 53/68 (77%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W N A +RL+MKNT QK GAS IEV++EVHEFTV D+SHP+S IY+MIDRL Q Sbjct: 533 AGDWMNVANIRLQMKNTVRQKPSGASSIEVEEEVHEFTVFDQSHPKSDDIYRMIDRLVQD 592 Query: 72 LKQVGYVP 49 L++V +VP Sbjct: 593 LQEVEFVP 600 >ref|XP_004306116.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Fragaria vesca subsp. vesca] Length = 605 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/64 (65%), Positives = 50/64 (78%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W+N A +RL+M++ +QK GAS IEVDDEVHEFTV DR HP SS IY MI+RLG+ Sbjct: 529 AGDWENMANMRLQMRSIGVQKTSGASSIEVDDEVHEFTVFDRVHPYSSDIYGMINRLGED 588 Query: 72 LKQV 61 LKQV Sbjct: 589 LKQV 592 >gb|EXB38041.1| hypothetical protein L484_020960 [Morus notabilis] Length = 599 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/71 (57%), Positives = 53/71 (74%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W++ A +R+RM++T IQK GAS IEV+DEVHEF V +SHPQS +IY+ I +L Q Sbjct: 529 AGDWESVATMRVRMRSTGIQKASGASSIEVNDEVHEFKVFHKSHPQSDKIYQTIGKLNQD 588 Query: 72 LKQVGYVPRAH 40 LK+V YVP H Sbjct: 589 LKRVEYVPIGH 599 >dbj|BAJ89066.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 639 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/71 (53%), Positives = 48/71 (67%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W + AK R++MK T QK G+S IE+D+ HEFTV DR H S +I +M+DRL H Sbjct: 564 AGQWSDMAKARMQMKGTGSQKSAGSSWIELDEAFHEFTVGDRKHSDSDQISEMVDRLSSH 623 Query: 72 LKQVGYVPRAH 40 +K VG VP AH Sbjct: 624 VKDVGCVPTAH 634 >ref|XP_006664140.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Oryza brachyantha] Length = 491 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/71 (50%), Positives = 48/71 (67%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W + AK R++MK T QK G+S +E+D+ HEFTV DR HP S +I +M+DRL H Sbjct: 416 AGQWSDMAKARMQMKGTGSQKTAGSSWVELDEAFHEFTVGDRKHPDSDQISEMVDRLSSH 475 Query: 72 LKQVGYVPRAH 40 +K+ G VP H Sbjct: 476 VKRAGCVPAGH 486 >ref|XP_003621319.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355496334|gb|AES77537.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 605 Score = 84.0 bits (206), Expect = 2e-14 Identities = 42/69 (60%), Positives = 49/69 (71%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 +G W N AKVR +M + QK G S IEV++EVHEFTV D SHP+S IY MIDRL Sbjct: 535 SGDWINVAKVRKQMNDEGGQKPSGVSSIEVEEEVHEFTVRDWSHPKSGDIYNMIDRLVHD 594 Query: 72 LKQVGYVPR 46 L+QVGYVPR Sbjct: 595 LRQVGYVPR 603 >ref|XP_006338411.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Solanum tuberosum] Length = 602 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/69 (56%), Positives = 50/69 (72%) Frame = -3 Query: 255 TAGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQ 76 +AG WDN A +RL MKN Q GASL+ ++DE EFTV D+SH +S +IY+M+DRLGQ Sbjct: 528 SAGDWDNVANIRLMMKNIGRPNQSGASLLLLNDEYREFTVMDKSHVKSDKIYQMVDRLGQ 587 Query: 75 HLKQVGYVP 49 HLK + VP Sbjct: 588 HLKLLSPVP 596 >ref|XP_007217279.1| hypothetical protein PRUPE_ppa017633mg [Prunus persica] gi|462413429|gb|EMJ18478.1| hypothetical protein PRUPE_ppa017633mg [Prunus persica] Length = 603 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/63 (63%), Positives = 47/63 (74%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W N A VRL+M+NT +QK GAS IEV DEVHEFTV D+ HP+S IY+MI+RL Q Sbjct: 527 AGDWANVANVRLQMRNTGVQKPSGASSIEVGDEVHEFTVFDKLHPKSGEIYQMIERLRQD 586 Query: 72 LKQ 64 KQ Sbjct: 587 FKQ 589 >ref|XP_002444640.1| hypothetical protein SORBIDRAFT_07g025280 [Sorghum bicolor] gi|241940990|gb|EES14135.1| hypothetical protein SORBIDRAFT_07g025280 [Sorghum bicolor] Length = 690 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/71 (54%), Positives = 48/71 (67%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W + AK R++MK T QK G+S IE+D+ HEFTV DR HP+S +I MIDRL H Sbjct: 615 AGKWSDMAKARVQMKGTGSQKTAGSSWIELDEAFHEFTVGDRKHPESDQISDMIDRLSSH 674 Query: 72 LKQVGYVPRAH 40 +K VG VP H Sbjct: 675 VKCVGCVPVGH 685 >ref|XP_004232191.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Solanum lycopersicum] Length = 602 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/69 (56%), Positives = 49/69 (71%) Frame = -3 Query: 255 TAGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQ 76 +AG WDN A +RL MKN Q G SL+ ++DE EFTV D+SH +S +IY+MIDRLGQ Sbjct: 528 SAGDWDNVANIRLMMKNIGRPNQSGGSLLLLNDEYREFTVMDKSHVKSDKIYQMIDRLGQ 587 Query: 75 HLKQVGYVP 49 HLK + VP Sbjct: 588 HLKLLSPVP 596 >ref|XP_007032637.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] gi|508711666|gb|EOY03563.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 672 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/64 (57%), Positives = 50/64 (78%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 +G WDN A +RLRMK+ +QK G+S IE+D+EVH+FTV D+SHP+ IY+MI+RL + Sbjct: 592 SGDWDNVASLRLRMKSIGVQKPSGSSSIEIDNEVHDFTVFDKSHPKFDGIYQMIERLRED 651 Query: 72 LKQV 61 LKQV Sbjct: 652 LKQV 655 >ref|XP_004962988.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Setaria italica] Length = 493 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/71 (49%), Positives = 48/71 (67%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W + AK R++MK T QK G+S IE+D+ HEFTV DR HP+S +I +M+ RL H Sbjct: 418 AGQWSDMAKARVQMKETGSQKTAGSSWIELDEAFHEFTVGDRKHPESEQISEMVGRLSSH 477 Query: 72 LKQVGYVPRAH 40 +K+ G +P H Sbjct: 478 VKRAGCIPAGH 488 >tpg|DAA48352.1| TPA: hypothetical protein ZEAMMB73_382586 [Zea mays] Length = 687 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/71 (53%), Positives = 48/71 (67%) Frame = -3 Query: 252 AGHWDNFAKVRLRMKNTNIQKQPGASLIEVDDEVHEFTVADRSHPQSSRIYKMIDRLGQH 73 AG W + AK R++MK T QK G+S IE+++ HEFTV DR HP+S +I MIDRL H Sbjct: 612 AGKWSDMAKARVQMKGTGSQKTAGSSWIELNEAFHEFTVGDRKHPESDQISDMIDRLSSH 671 Query: 72 LKQVGYVPRAH 40 +K VG VP H Sbjct: 672 VKFVGCVPVGH 682