BLASTX nr result
ID: Akebia25_contig00055988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055988 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284121.1| PREDICTED: auxin-induced protein 22D [Vitis ... 72 1e-10 ref|XP_007050424.1| AUX/IAA transcriptional regulator family pro... 68 2e-09 ref|XP_007034953.1| AUX/IAA transcriptional regulator family pro... 67 3e-09 ref|XP_002517024.1| Auxin-responsive protein IAA4, putative [Ric... 66 6e-09 ref|XP_006420092.1| hypothetical protein CICLE_v10006002mg [Citr... 64 2e-08 ref|XP_006420091.1| hypothetical protein CICLE_v10006002mg [Citr... 64 2e-08 ref|XP_002279955.1| PREDICTED: auxin-induced protein 22D [Vitis ... 64 2e-08 emb|CAN74317.1| hypothetical protein VITISV_013837 [Vitis vinifera] 64 2e-08 gb|AAU04408.1| auxin-induced protein 22D [Citrus limon] 64 2e-08 ref|XP_002300804.2| auxin-induced protein 22B [Populus trichocar... 64 3e-08 ref|XP_002307625.1| auxin-induced protein 22B [Populus trichocar... 61 2e-07 gb|AFZ78614.1| hypothetical protein [Populus tomentosa] 60 3e-07 ref|XP_003591816.1| Auxin-induced protein [Medicago truncatula] ... 60 3e-07 gb|ACJ84063.1| unknown [Medicago truncatula] 60 3e-07 gb|AAQ74955.1| Gbiaa-Re [Gossypium barbadense] 59 7e-07 ref|XP_002314656.2| hypothetical protein POPTR_0010s08890g [Popu... 58 1e-06 ref|XP_002281696.1| PREDICTED: auxin-induced protein 22D [Vitis ... 56 5e-06 gb|AEE25649.1| auxin-responsive protein [Gossypium hirsutum] 56 6e-06 ref|XP_004495393.1| PREDICTED: auxin-induced protein 22B-like [C... 55 8e-06 >ref|XP_002284121.1| PREDICTED: auxin-induced protein 22D [Vitis vinifera] gi|297737155|emb|CBI26356.3| unnamed protein product [Vitis vinifera] Length = 192 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVKSNKRALGEIGDDCGSK 9 MEG V YE+DLNLKATELRLGLPG DE+E+ V++NKRA + D+CGSK Sbjct: 1 MEGAVAYESDLNLKATELRLGLPGRDEAEKEALSGVRNNKRASPDTSDECGSK 53 >ref|XP_007050424.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao] gi|508702685|gb|EOX94581.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao] Length = 406 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVKSNKRALGEIGDDCGSKDN 3 ME V Y+NDLNLKATELRLGLPGSDE E+ P +++NKR+ EI ++ SK + Sbjct: 209 MERRVNYQNDLNLKATELRLGLPGSDEPEKQSTPCIRNNKRSSSEISEESRSKSS 263 >ref|XP_007034953.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao] gi|508713982|gb|EOY05879.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao] Length = 192 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVKSNKRALGEIGDDCGS 12 MEG V YENDLNLKATELRLGLPG+DE EE NV++ KR L + ++ G+ Sbjct: 1 MEGSVAYENDLNLKATELRLGLPGTDEREEQSVSNVRNKKRPLQDADEEFGA 52 >ref|XP_002517024.1| Auxin-responsive protein IAA4, putative [Ricinus communis] gi|223543659|gb|EEF45187.1| Auxin-responsive protein IAA4, putative [Ricinus communis] Length = 191 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPN-VKSNKRALGEIGDDCGSK 9 MEG V YENDLNLKATELRLGLPG++ +EE + ++NKR L E D+CG K Sbjct: 1 MEGAVAYENDLNLKATELRLGLPGTERNEEQAALSCTRNNKRPLPETRDECGEK 54 >ref|XP_006420092.1| hypothetical protein CICLE_v10006002mg [Citrus clementina] gi|568872696|ref|XP_006489502.1| PREDICTED: auxin-induced protein 22D-like [Citrus sinensis] gi|557521965|gb|ESR33332.1| hypothetical protein CICLE_v10006002mg [Citrus clementina] Length = 184 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVKSNKRALGEIGDDCGSKD 6 ME V YENDLNLKATELRLGLPGSDE+E+ ++NKR+L + DD +KD Sbjct: 1 METSVPYENDLNLKATELRLGLPGSDENEQ----QTRNNKRSLPDTPDDLDTKD 50 >ref|XP_006420091.1| hypothetical protein CICLE_v10006002mg [Citrus clementina] gi|557521964|gb|ESR33331.1| hypothetical protein CICLE_v10006002mg [Citrus clementina] Length = 161 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVKSNKRALGEIGDDCGSKD 6 ME V YENDLNLKATELRLGLPGSDE+E+ ++NKR+L + DD +KD Sbjct: 1 METSVPYENDLNLKATELRLGLPGSDENEQ----QTRNNKRSLPDTPDDLDTKD 50 >ref|XP_002279955.1| PREDICTED: auxin-induced protein 22D [Vitis vinifera] gi|298204847|emb|CBI34154.3| unnamed protein product [Vitis vinifera] Length = 199 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/56 (57%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVK-SNKRALGEIGDDCGSKDN 3 ME V YE DLNL+ATELRLGLPG+ + E+ PP++K SNKRAL ++ ++ GS +N Sbjct: 1 MENKVIYEKDLNLEATELRLGLPGTKKPEKQAPPSLKTSNKRALPDMNEESGSGNN 56 >emb|CAN74317.1| hypothetical protein VITISV_013837 [Vitis vinifera] Length = 206 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/56 (57%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVK-SNKRALGEIGDDCGSKDN 3 ME V YE DLNL+ATELRLGLPG+ + E+ PP++K SNKRAL ++ ++ GS +N Sbjct: 1 MENKVIYEKDLNLEATELRLGLPGTKKPEKQAPPSLKTSNKRALPDMNEESGSGNN 56 >gb|AAU04408.1| auxin-induced protein 22D [Citrus limon] Length = 111 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVKSNKRALGEIGDDCGSKD 6 ME V YENDLNLKATELRLGLPGSDE+E+ ++NKR+L + DD +KD Sbjct: 1 METSVPYENDLNLKATELRLGLPGSDENEQ----QTRNNKRSLPDTPDDLDTKD 50 >ref|XP_002300804.2| auxin-induced protein 22B [Populus trichocarpa] gi|550344276|gb|EEE80077.2| auxin-induced protein 22B [Populus trichocarpa] Length = 199 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/54 (62%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEE-HPPPNVKSNKRALGEIGDDCGSK 9 ME + YE LNLKATELRLGLPGSDE E+ P+V+SNKRA EI ++ GSK Sbjct: 1 MERSMAYERHLNLKATELRLGLPGSDEPEKPSTTPSVRSNKRASPEISEESGSK 54 >ref|XP_002307625.1| auxin-induced protein 22B [Populus trichocarpa] gi|222857074|gb|EEE94621.1| auxin-induced protein 22B [Populus trichocarpa] Length = 195 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -2 Query: 149 YENDLNLKATELRLGLPGSDESEE-HPPPNVKSNKRALGEIGDDCGSK 9 YE+DLNLKATELRLGLPGSDE E+ P+V+SNKRA EI ++ SK Sbjct: 3 YESDLNLKATELRLGLPGSDEPEKPSTTPSVRSNKRASPEISEESRSK 50 >gb|AFZ78614.1| hypothetical protein [Populus tomentosa] Length = 203 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/56 (58%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPG-SDESEEHPPPNVKSNKRALGEIGDDCGSKDN 3 MEG V YENDLNLKATELRLGLPG S +EE ++NKR L E ++ G+K N Sbjct: 1 MEGGVAYENDLNLKATELRLGLPGTSCTNEEQAVSGARNNKRPLPETREERGAKGN 56 >ref|XP_003591816.1| Auxin-induced protein [Medicago truncatula] gi|355480864|gb|AES62067.1| Auxin-induced protein [Medicago truncatula] gi|388507764|gb|AFK41948.1| unknown [Medicago truncatula] Length = 178 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVKSNKRALGEIGDDCGSK 9 ME V YENDLN+KATELRLGLPG++++EE SNKR L E D GSK Sbjct: 1 MENKVAYENDLNMKATELRLGLPGTEQNEEQKAK--ISNKRPLTETSKDSGSK 51 >gb|ACJ84063.1| unknown [Medicago truncatula] Length = 122 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVKSNKRALGEIGDDCGSK 9 ME V YENDLN+KATELRLGLPG++++EE SNKR L E D GSK Sbjct: 1 MENKVAYENDLNMKATELRLGLPGTEQNEEQKAK--ISNKRPLTETSKDSGSK 51 >gb|AAQ74955.1| Gbiaa-Re [Gossypium barbadense] Length = 190 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/52 (59%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVKSNKRALGEIG-DDCG 15 MEG V Y+NDLNL+ATELRLGLPG++ P V+SNKR+L ++ DDCG Sbjct: 1 MEGSVGYDNDLNLRATELRLGLPGTE-----PVSIVRSNKRSLQQVADDDCG 47 >ref|XP_002314656.2| hypothetical protein POPTR_0010s08890g [Populus trichocarpa] gi|550329400|gb|EEF00827.2| hypothetical protein POPTR_0010s08890g [Populus trichocarpa] Length = 297 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPG-SDESEEHPPPNVKSNKRALGEIGDDCGSK 9 MEG V YENDLNLKATELRLGLPG S +EE ++NKR L E ++ G+K Sbjct: 106 MEGGVAYENDLNLKATELRLGLPGTSCTNEEQAVSGARNNKRPLPETREERGAK 159 >ref|XP_002281696.1| PREDICTED: auxin-induced protein 22D [Vitis vinifera] gi|297735491|emb|CBI17931.3| unnamed protein product [Vitis vinifera] Length = 186 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVKSNKRALGEIGDDCGSKDN 3 ME V Y+N LNL+ATELRLGLPG++E E+ +V+S KRA E+ ++ SK + Sbjct: 1 MEKPVVYDNGLNLEATELRLGLPGTNEPEKQSSTSVRSKKRASPEMAEETRSKSS 55 >gb|AEE25649.1| auxin-responsive protein [Gossypium hirsutum] Length = 200 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/57 (50%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLP--GSDESEEHPPPNVKSNKRALGEIGDDCGSKDN 3 ME V YENDLNL ATE RLGLP G DE + P++++NKR + EI + S+ N Sbjct: 1 MERRVNYENDLNLMATEPRLGLPGCGDDEPQRKTNPSIRNNKRTVPEISEVSSSESN 57 >ref|XP_004495393.1| PREDICTED: auxin-induced protein 22B-like [Cicer arietinum] Length = 183 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/55 (54%), Positives = 38/55 (69%) Frame = -2 Query: 167 MEGMVKYENDLNLKATELRLGLPGSDESEEHPPPNVKSNKRALGEIGDDCGSKDN 3 ME V Y+ DLNLKATELRLGLPG++E+ +VK+NKR L E +C SK + Sbjct: 1 MENSVAYQTDLNLKATELRLGLPGTEET--LLSVSVKNNKRPLIETSKECDSKSS 53