BLASTX nr result
ID: Akebia25_contig00055718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055718 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 emb|CAN70142.1| hypothetical protein VITISV_032085 [Vitis vinifera] 70 4e-10 ref|XP_006847830.1| hypothetical protein AMTR_s00029p00051540 [A... 66 6e-09 ref|XP_002524455.1| pentatricopeptide repeat-containing protein,... 66 6e-09 ref|XP_007013367.1| Tetratricopeptide repeat (TPR)-like superfam... 65 8e-09 ref|XP_007203957.1| hypothetical protein PRUPE_ppa022872mg [Prun... 65 8e-09 gb|EYU45574.1| hypothetical protein MIMGU_mgv1a001941mg [Mimulus... 63 4e-08 gb|EXC20880.1| hypothetical protein L484_012956 [Morus notabilis] 63 4e-08 ref|XP_006838872.1| hypothetical protein AMTR_s00002p00267080 [A... 63 4e-08 ref|XP_006421782.1| hypothetical protein CICLE_v10004643mg [Citr... 63 5e-08 ref|XP_007014996.1| Slow growth 1, putative [Theobroma cacao] gi... 62 8e-08 ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citr... 61 1e-07 ref|XP_002324235.2| pentatricopeptide repeat-containing family p... 61 1e-07 ref|XP_006842814.1| hypothetical protein AMTR_s00081p00056740 [A... 61 1e-07 ref|XP_007214270.1| hypothetical protein PRUPE_ppa026204mg [Prun... 61 1e-07 gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] 60 3e-07 ref|XP_006364895.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_004154678.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 59 7e-07 ref|XP_004139112.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 >ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 738 Score = 69.7 bits (169), Expect = 4e-10 Identities = 38/84 (45%), Positives = 52/84 (61%), Gaps = 6/84 (7%) Frame = +3 Query: 30 PPCPLH------KTRKLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTK 191 PP LH KL ++P L+LL +CK+ + LKQ+H+QIIK + + A +K Sbjct: 13 PPPTLHFQPTSDPPYKLLQNHPSLTLLSTCKSFQNLKQIHSQIIKT---GLHNTQFALSK 69 Query: 192 LISFCAISPYGNLDYAKILFNHLE 263 LI FCAISP+GNL YA +LF +E Sbjct: 70 LIEFCAISPFGNLSYALLLFESIE 93 >emb|CAN70142.1| hypothetical protein VITISV_032085 [Vitis vinifera] Length = 748 Score = 69.7 bits (169), Expect = 4e-10 Identities = 38/84 (45%), Positives = 52/84 (61%), Gaps = 6/84 (7%) Frame = +3 Query: 30 PPCPLH------KTRKLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTK 191 PP LH KL ++P L+LL +CK+ + LKQ+H+QIIK + + A +K Sbjct: 13 PPPTLHFQPTSDPPYKLLQNHPSLTLLSTCKSFQNLKQIHSQIIKT---GLHNTQFALSK 69 Query: 192 LISFCAISPYGNLDYAKILFNHLE 263 LI FCAISP+GNL YA +LF +E Sbjct: 70 LIEFCAISPFGNLSYALLLFESIE 93 >ref|XP_006847830.1| hypothetical protein AMTR_s00029p00051540 [Amborella trichopoda] gi|548851135|gb|ERN09411.1| hypothetical protein AMTR_s00029p00051540 [Amborella trichopoda] Length = 181 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/63 (52%), Positives = 48/63 (76%) Frame = +3 Query: 75 PILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFCAISPYGNLDYAKILFN 254 PILSLLDSC +M +LKQ+HA II Q LS S+ ++LI+FCA+SPY ++D+AK++F Sbjct: 13 PILSLLDSCTHMNQLKQIHAHIIIQ-GLS--RSNFTGSRLIAFCAVSPYASIDHAKLIFA 69 Query: 255 HLE 263 ++ Sbjct: 70 QIQ 72 >ref|XP_002524455.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223536243|gb|EEF37895.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 486 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/68 (45%), Positives = 46/68 (67%) Frame = +3 Query: 57 KLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFCAISPYGNLDY 236 K ++P L+LL +CKN++ LKQ+H+Q+IK + + A +KLI FC ISPYG+L Y Sbjct: 20 KFLQTHPSLTLLSTCKNLKTLKQIHSQVIK---TGLHNTHFALSKLIEFCVISPYGDLSY 76 Query: 237 AKILFNHL 260 A +LF + Sbjct: 77 ALLLFKSI 84 >ref|XP_007013367.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] gi|508783730|gb|EOY30986.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 847 Score = 65.5 bits (158), Expect = 8e-09 Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 6/91 (6%) Frame = +3 Query: 9 PISRKSFPPCPLH------KTRKLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYE 170 P + S P PLH KL ++P LSLL C+ ++ LKQ+H IIK + Sbjct: 62 PSTSVSISPFPLHLLPSSDPPYKLLQNHPSLSLLSKCRTIQTLKQVHCHIIKT---GLHH 118 Query: 171 SSSATTKLISFCAISPYGNLDYAKILFNHLE 263 + A +KLI FCA+SP+G+L YA +LF ++ Sbjct: 119 TQFALSKLIEFCAVSPFGDLPYALLLFESID 149 >ref|XP_007203957.1| hypothetical protein PRUPE_ppa022872mg [Prunus persica] gi|462399488|gb|EMJ05156.1| hypothetical protein PRUPE_ppa022872mg [Prunus persica] Length = 714 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/69 (46%), Positives = 46/69 (66%) Frame = +3 Query: 57 KLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFCAISPYGNLDY 236 KL + P L+LL CK+M+ LKQ+HA IIK + + A +KL+ FCAISP+G+L Y Sbjct: 29 KLLQTQPSLTLLSKCKSMQNLKQVHAHIIK---TGLHNTHFALSKLVEFCAISPFGDLSY 85 Query: 237 AKILFNHLE 263 A ++F +E Sbjct: 86 ALLVFQSIE 94 >gb|EYU45574.1| hypothetical protein MIMGU_mgv1a001941mg [Mimulus guttatus] Length = 736 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/78 (39%), Positives = 45/78 (57%) Frame = +3 Query: 27 FPPCPLHKTRKLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFC 206 F P +L NP LSLL C++++ KQ+H+ IK + + A +KLI FC Sbjct: 15 FLPSSTDPPYELLKENPSLSLLSKCRSIKTFKQIHSHFIK---FGLHNTQFAVSKLIDFC 71 Query: 207 AISPYGNLDYAKILFNHL 260 A+SPYGNL YA +F+ + Sbjct: 72 AVSPYGNLSYAVSIFDSI 89 >gb|EXC20880.1| hypothetical protein L484_012956 [Morus notabilis] Length = 540 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/65 (44%), Positives = 43/65 (66%) Frame = +3 Query: 72 NPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFCAISPYGNLDYAKILF 251 N +L L++ CKNMRELKQ+H QIIK +++ ++L+ FCAIS G+L YA +F Sbjct: 14 NALLRLIEECKNMRELKQIHTQIIKSTSITQSHQLLLLSRLLFFCAISNLGSLSYANDIF 73 Query: 252 NHLEI 266 ++I Sbjct: 74 RAIKI 78 >ref|XP_006838872.1| hypothetical protein AMTR_s00002p00267080 [Amborella trichopoda] gi|548841378|gb|ERN01441.1| hypothetical protein AMTR_s00002p00267080 [Amborella trichopoda] Length = 275 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/93 (37%), Positives = 56/93 (60%), Gaps = 7/93 (7%) Frame = +3 Query: 3 TTP-ISRKSFPPCPLHKTRKLFPS------NPILSLLDSCKNMRELKQLHAQIIKQENLS 161 T+P I + PP P T K +P L++L +C NMR LKQ+HA +++ +S Sbjct: 10 TSPTIHHPNLPPPPPELTPKWHAKAASMSVHPCLTMLQTCPNMRTLKQIHAHMLRLHLVS 69 Query: 162 PYESSSATTKLISFCAISPYGNLDYAKILFNHL 260 + ++L++FCA+SP G+LDYA++LF+ L Sbjct: 70 ---DTFCVSRLVAFCALSPKGSLDYARLLFSQL 99 >ref|XP_006421782.1| hypothetical protein CICLE_v10004643mg [Citrus clementina] gi|568874334|ref|XP_006490271.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] gi|557523655|gb|ESR35022.1| hypothetical protein CICLE_v10004643mg [Citrus clementina] Length = 569 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 6/80 (7%) Frame = +3 Query: 42 LHKTRKLFPSNP------ILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISF 203 L+ K+ P N + + +D CKNMRELK++H QIIK L + S T+L+ F Sbjct: 13 LNSPAKVSPPNKESTKLILRNAIDECKNMRELKEIHTQIIKSPCLQTNDHHSLITRLLFF 72 Query: 204 CAISPYGNLDYAKILFNHLE 263 CA+S G+L YA +F+H++ Sbjct: 73 CALSVSGSLSYATNVFSHIK 92 >ref|XP_007014996.1| Slow growth 1, putative [Theobroma cacao] gi|508785359|gb|EOY32615.1| Slow growth 1, putative [Theobroma cacao] Length = 702 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/76 (44%), Positives = 52/76 (68%), Gaps = 1/76 (1%) Frame = +3 Query: 30 PPCPLHKTRKLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFCA 209 PP +KT L SNP+LS+L CK++ +LKQ+ AQ+ + ++S + SS +LI+FCA Sbjct: 44 PPANGNKTHALLLSNPVLSILQICKSLPQLKQIQAQMTIKGSMSDWFFSS---RLIAFCA 100 Query: 210 ISPYGNLDYA-KILFN 254 +S + NLD+ KIL+N Sbjct: 101 LSEHKNLDHCIKILYN 116 >ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Citrus sinensis] Length = 736 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/75 (42%), Positives = 46/75 (61%) Frame = +3 Query: 27 FPPCPLHKTRKLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFC 206 FPP KL + P L+LL C NM+ +KQ+H+QIIK + + A +KLI C Sbjct: 17 FPPSS-DPPYKLLQNQPSLALLSKCTNMQNIKQVHSQIIK---TGLHNTQFALSKLIEIC 72 Query: 207 AISPYGNLDYAKILF 251 A+SP+G+L YA ++F Sbjct: 73 AVSPFGDLSYALLVF 87 >ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] gi|557554208|gb|ESR64222.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] Length = 736 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/75 (42%), Positives = 46/75 (61%) Frame = +3 Query: 27 FPPCPLHKTRKLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFC 206 FPP KL + P L+LL C NM+ +KQ+H+QIIK + + A +KLI C Sbjct: 17 FPPSS-DPPYKLLQNQPSLALLSKCTNMQNIKQVHSQIIK---TGLHNTQFALSKLIEIC 72 Query: 207 AISPYGNLDYAKILF 251 A+SP+G+L YA ++F Sbjct: 73 AVSPFGDLSYALLVF 87 >ref|XP_002324235.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550317719|gb|EEF02800.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 736 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/65 (47%), Positives = 44/65 (67%) Frame = +3 Query: 57 KLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFCAISPYGNLDY 236 KL +P L+LL +CK ++ LKQ+H+QIIK + + A +KLI FCA+SP+G+L Y Sbjct: 24 KLVHDHPSLTLLSNCKTLQTLKQIHSQIIK---TGLHNTHFALSKLIEFCAVSPHGDLSY 80 Query: 237 AKILF 251 A LF Sbjct: 81 ALSLF 85 >ref|XP_006842814.1| hypothetical protein AMTR_s00081p00056740 [Amborella trichopoda] gi|548844970|gb|ERN04489.1| hypothetical protein AMTR_s00081p00056740 [Amborella trichopoda] Length = 406 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/83 (39%), Positives = 48/83 (57%), Gaps = 2/83 (2%) Frame = +3 Query: 9 PISRKSFPPCPLHKTRKL--FPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSA 182 P+S P + K R +P L LL SC +M++LKQ+HAQ K + A Sbjct: 11 PLSSPQQLPLSISKLRHTNSIKDHPTLFLLQSCTSMKQLKQIHAQFFKT---GLHNDQFA 67 Query: 183 TTKLISFCAISPYGNLDYAKILF 251 +K+I FC+ISP+G+LD+A +LF Sbjct: 68 LSKIIEFCSISPFGDLDFAHLLF 90 >ref|XP_007214270.1| hypothetical protein PRUPE_ppa026204mg [Prunus persica] gi|462410135|gb|EMJ15469.1| hypothetical protein PRUPE_ppa026204mg [Prunus persica] Length = 684 Score = 61.2 bits (147), Expect = 1e-07 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 1/85 (1%) Frame = +3 Query: 3 TTPISRKSFPPCPLHKTRKLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSA 182 T +S P + T K +NP+LSLL++CK+M +LKQ+ +Q+I +S A Sbjct: 26 TRSLSPHKHKPINWNTTHKSVQANPLLSLLETCKSMSQLKQIQSQMILTGLIS---DGFA 82 Query: 183 TTKLISFCAISPYGNLDYA-KILFN 254 +++LI+FCA+S NLDY KIL+N Sbjct: 83 SSRLIAFCALSESRNLDYCNKILYN 107 >gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] Length = 737 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/69 (40%), Positives = 46/69 (66%) Frame = +3 Query: 57 KLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFCAISPYGNLDY 236 KL S+P L+LL CK+++ LKQ+H IIK +++ A +KL+ FC++SP+G+L Y Sbjct: 27 KLLQSHPSLNLLSKCKSLQTLKQIHTHIIK---TGLHKTQFALSKLVEFCSLSPFGDLSY 83 Query: 237 AKILFNHLE 263 A + + +E Sbjct: 84 ALAILDTIE 92 >ref|XP_006364895.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Solanum tuberosum] Length = 731 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/66 (42%), Positives = 40/66 (60%) Frame = +3 Query: 57 KLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFCAISPYGNLDY 236 KL ++P SLL CKNM +LK++H+ IK + + A +KL+ FCA PYG+ Y Sbjct: 21 KLLQTHPSFSLLSKCKNMEDLKKVHSHFIK---FGLHNTQFALSKLLEFCATKPYGDFSY 77 Query: 237 AKILFN 254 A +FN Sbjct: 78 ALSIFN 83 >ref|XP_004154678.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Cucumis sativus] Length = 681 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/75 (38%), Positives = 48/75 (64%) Frame = +3 Query: 33 PCPLHKTRKLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFCAI 212 P + + L SNP+LSLL++C +M ++K++HAQ+I +S A ++L++FCAI Sbjct: 42 PTNWNASHVLIQSNPLLSLLEACTSMAKMKEIHAQMISTGLIS---DGFALSRLVAFCAI 98 Query: 213 SPYGNLDYAKILFNH 257 S + NLDY + N+ Sbjct: 99 SEWRNLDYCDKILNN 113 >ref|XP_004139112.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Cucumis sativus] Length = 681 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/75 (38%), Positives = 48/75 (64%) Frame = +3 Query: 33 PCPLHKTRKLFPSNPILSLLDSCKNMRELKQLHAQIIKQENLSPYESSSATTKLISFCAI 212 P + + L SNP+LSLL++C +M ++K++HAQ+I +S A ++L++FCAI Sbjct: 42 PTNWNASHVLIQSNPLLSLLEACTSMAKMKEIHAQMISTGLIS---DGFALSRLVAFCAI 98 Query: 213 SPYGNLDYAKILFNH 257 S + NLDY + N+ Sbjct: 99 SEWRNLDYCDKILNN 113