BLASTX nr result
ID: Akebia25_contig00055697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055697 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN80288.1| hypothetical protein VITISV_006820 [Vitis vinifera] 52 6e-06 >emb|CAN80288.1| hypothetical protein VITISV_006820 [Vitis vinifera] Length = 1894 Score = 51.6 bits (122), Expect(2) = 6e-06 Identities = 23/51 (45%), Positives = 31/51 (60%) Frame = -3 Query: 267 KLPSKVTFFIWTTALNKIPTLDKLISKGLPIMKVCYLCETNGESVDHIFKH 115 ++P+KV+FF W A KI TLDKL +G + CYLC E+ +HI H Sbjct: 1784 RVPTKVSFFAWEAAWGKILTLDKLQRRGXQLPNRCYLCGCEEENANHILLH 1834 Score = 23.9 bits (50), Expect(2) = 6e-06 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 85 IVLMRIKWVFPKSVFLLFH 29 +V+ ++WVFPK V + H Sbjct: 1846 LVIFXVQWVFPKGVRGVLH 1864