BLASTX nr result
ID: Akebia25_contig00055640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055640 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA43083.1| hypothetical protein NCU16895 [Neurospora crassa ... 60 4e-07 gb|EXJ59159.1| hypothetical protein A1O7_06590 [Cladophialophora... 56 5e-06 ref|XP_002147372.1| carbonyl reductase, putative [Talaromyces ma... 56 6e-06 >gb|ESA43083.1| hypothetical protein NCU16895 [Neurospora crassa OR74A] Length = 259 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -1 Query: 122 EKTIVLITGANRGLGYETAKALARDHSDYHVLIGSRSL 9 EKT+VLITGAN+G+GYETAK+L +DYHV++GSR + Sbjct: 5 EKTVVLITGANQGIGYETAKSLVHSSADYHVILGSRDI 42 >gb|EXJ59159.1| hypothetical protein A1O7_06590 [Cladophialophora yegresii CBS 114405] Length = 252 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = -1 Query: 125 AEKTIVLITGANRGLGYETAKALARDHSDYHVLIGSRSLE 6 ++ T+VL++GAN+GLGYET K LA + ++YH+L+GSRS E Sbjct: 6 SDHTLVLVSGANQGLGYETVKKLAAEQANYHILLGSRSFE 45 >ref|XP_002147372.1| carbonyl reductase, putative [Talaromyces marneffei ATCC 18224] gi|210069771|gb|EEA23861.1| carbonyl reductase, putative [Talaromyces marneffei ATCC 18224] Length = 248 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 119 KTIVLITGANRGLGYETAKALARDHSDYHVLIGSR 15 K IVLITGANRG+GY A+ LAR+H +YH++IGSR Sbjct: 4 KAIVLITGANRGIGYGVARKLAREHPNYHIIIGSR 38