BLASTX nr result
ID: Akebia25_contig00055551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055551 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptas... 40 6e-07 >gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 243 Score = 39.7 bits (91), Expect(2) = 6e-07 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 273 LGRFGLSWLTKLFNDILKPKKMLDD 199 LG G+ WLTKLFN+I+K KKMLD+ Sbjct: 48 LGDRGIVWLTKLFNEIMKTKKMLDE 72 Score = 39.3 bits (90), Expect(2) = 6e-07 Identities = 17/35 (48%), Positives = 26/35 (74%) Frame = -2 Query: 223 KT*KDVG*WRKCIVIPIYNNKGNIENYTNHQGIEL 119 KT K + WR+ +IPIY NKG+I++ N++GI+L Sbjct: 65 KTKKMLDEWRRSTLIPIYKNKGDIQHCANYRGIKL 99