BLASTX nr result
ID: Akebia25_contig00055412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055412 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON68697.1| hypothetical protein W97_07955 [Coniosporium apol... 57 2e-06 gb|EOA81265.1| hypothetical protein SETTUDRAFT_122843 [Setosphae... 56 6e-06 ref|XP_003838664.1| hypothetical protein LEMA_P116000.1 [Leptosp... 56 6e-06 ref|XP_001791588.1| hypothetical protein SNOG_00921 [Phaeosphaer... 56 6e-06 ref|XP_003298029.1| hypothetical protein PTT_08610 [Pyrenophora ... 55 8e-06 >gb|EON68697.1| hypothetical protein W97_07955 [Coniosporium apollinis CBS 100218] Length = 700 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 109 TGEKQTIQARHGVATFVPQGHTLTIINTYGRQTV 8 +GE+QTI ARHG ATFVP+GHT+ IINTYG Q V Sbjct: 2 SGEQQTIPARHGTATFVPRGHTIKIINTYGHQVV 35 >gb|EOA81265.1| hypothetical protein SETTUDRAFT_122843 [Setosphaeria turcica Et28A] Length = 555 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 109 TGEKQTIQARHGVATFVPQGHTLTIINTYGRQTVGL 2 +GE QTI ARHGVATFVP+G T+ +INTYG+Q V + Sbjct: 2 SGELQTIPARHGVATFVPRGRTIKVINTYGKQVVSM 37 >ref|XP_003838664.1| hypothetical protein LEMA_P116000.1 [Leptosphaeria maculans JN3] gi|312215232|emb|CBX95185.1| hypothetical protein LEMA_P116000.1 [Leptosphaeria maculans JN3] Length = 626 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 109 TGEKQTIQARHGVATFVPQGHTLTIINTYGRQTVGL 2 +GE QTI ARHGVATFVP+G T+ +INTYG+Q V + Sbjct: 51 SGELQTIPARHGVATFVPRGRTIKVINTYGKQVVSM 86 >ref|XP_001791588.1| hypothetical protein SNOG_00921 [Phaeosphaeria nodorum SN15] gi|160701284|gb|EAT92416.2| hypothetical protein SNOG_00921 [Phaeosphaeria nodorum SN15] Length = 579 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 109 TGEKQTIQARHGVATFVPQGHTLTIINTYGRQTVGL 2 +GE QTI ARHGVATFVP+G T+ +INTYG+Q V + Sbjct: 42 SGELQTIPARHGVATFVPRGRTIKVINTYGKQVVSM 77 >ref|XP_003298029.1| hypothetical protein PTT_08610 [Pyrenophora teres f. teres 0-1] gi|311329001|gb|EFQ93876.1| hypothetical protein PTT_08610 [Pyrenophora teres f. teres 0-1] Length = 571 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 109 TGEKQTIQARHGVATFVPQGHTLTIINTYGRQTVGL 2 +GE QTI ARHGVATFVP+G T+ +INTYG+Q V + Sbjct: 2 SGELQTIPARHGVATFVPRGRTIKVINTYGQQVVSM 37