BLASTX nr result
ID: Akebia25_contig00055318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055318 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006489494.1| PREDICTED: acylamino-acid-releasing enzyme-l... 60 2e-07 ref|XP_006420084.1| hypothetical protein CICLE_v10004325mg [Citr... 60 2e-07 ref|XP_006420083.1| hypothetical protein CICLE_v10004325mg [Citr... 60 2e-07 ref|XP_002312565.2| hypothetical protein POPTR_0008s16030g [Popu... 59 7e-07 ref|XP_004498003.1| PREDICTED: acylamino-acid-releasing enzyme-l... 59 9e-07 ref|XP_004498002.1| PREDICTED: acylamino-acid-releasing enzyme-l... 59 9e-07 ref|XP_004498001.1| PREDICTED: acylamino-acid-releasing enzyme-l... 59 9e-07 ref|XP_004498000.1| PREDICTED: acylamino-acid-releasing enzyme-l... 59 9e-07 ref|XP_004497999.1| PREDICTED: acylamino-acid-releasing enzyme-l... 59 9e-07 ref|XP_004497998.1| PREDICTED: acylamino-acid-releasing enzyme-l... 59 9e-07 ref|XP_006362173.1| PREDICTED: acylamino-acid-releasing enzyme-l... 58 1e-06 ref|XP_006362171.1| PREDICTED: acylamino-acid-releasing enzyme-l... 58 1e-06 ref|XP_007225244.1| hypothetical protein PRUPE_ppa001729mg [Prun... 58 1e-06 ref|XP_004247631.1| PREDICTED: acylamino-acid-releasing enzyme-l... 58 1e-06 ref|XP_003637575.1| Acylamino-acid-releasing enzyme [Medicago tr... 58 1e-06 ref|XP_002284013.2| PREDICTED: acylamino-acid-releasing enzyme-l... 58 1e-06 gb|EYU33017.1| hypothetical protein MIMGU_mgv1a001397mg [Mimulus... 58 2e-06 gb|EYU33016.1| hypothetical protein MIMGU_mgv1a001397mg [Mimulus... 58 2e-06 ref|XP_003536827.2| PREDICTED: acylamino-acid-releasing enzyme-l... 58 2e-06 ref|XP_006588524.1| PREDICTED: acylamino-acid-releasing enzyme-l... 58 2e-06 >ref|XP_006489494.1| PREDICTED: acylamino-acid-releasing enzyme-like [Citrus sinensis] Length = 826 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +SSVD+GAHSATDSLHRID Sbjct: 379 FSPDGKFLVFLSAKSSVDSGAHSATDSLHRID 410 >ref|XP_006420084.1| hypothetical protein CICLE_v10004325mg [Citrus clementina] gi|557521957|gb|ESR33324.1| hypothetical protein CICLE_v10004325mg [Citrus clementina] Length = 826 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +SSVD+GAHSATDSLHRID Sbjct: 379 FSPDGKFLVFLSAKSSVDSGAHSATDSLHRID 410 >ref|XP_006420083.1| hypothetical protein CICLE_v10004325mg [Citrus clementina] gi|557521956|gb|ESR33323.1| hypothetical protein CICLE_v10004325mg [Citrus clementina] Length = 771 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +SSVD+GAHSATDSLHRID Sbjct: 324 FSPDGKFLVFLSAKSSVDSGAHSATDSLHRID 355 >ref|XP_002312565.2| hypothetical protein POPTR_0008s16030g [Populus trichocarpa] gi|550333179|gb|EEE89932.2| hypothetical protein POPTR_0008s16030g [Populus trichocarpa] Length = 831 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDG+FLVFLS +SSVD+GAHSATDSLHRID Sbjct: 384 FSPDGRFLVFLSGRSSVDSGAHSATDSLHRID 415 >ref|XP_004498003.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X6 [Cicer arietinum] Length = 822 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +SSVD+GAHSAT+SLHRID Sbjct: 374 FSPDGKFLVFLSARSSVDSGAHSATNSLHRID 405 >ref|XP_004498002.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X5 [Cicer arietinum] Length = 823 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +SSVD+GAHSAT+SLHRID Sbjct: 375 FSPDGKFLVFLSARSSVDSGAHSATNSLHRID 406 >ref|XP_004498001.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X4 [Cicer arietinum] Length = 825 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +SSVD+GAHSAT+SLHRID Sbjct: 377 FSPDGKFLVFLSARSSVDSGAHSATNSLHRID 408 >ref|XP_004498000.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X3 [Cicer arietinum] Length = 826 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +SSVD+GAHSAT+SLHRID Sbjct: 378 FSPDGKFLVFLSARSSVDSGAHSATNSLHRID 409 >ref|XP_004497999.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Cicer arietinum] Length = 833 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +SSVD+GAHSAT+SLHRID Sbjct: 405 FSPDGKFLVFLSARSSVDSGAHSATNSLHRID 436 >ref|XP_004497998.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Cicer arietinum] Length = 852 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +SSVD+GAHSAT+SLHRID Sbjct: 404 FSPDGKFLVFLSARSSVDSGAHSATNSLHRID 435 >ref|XP_006362173.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X3 [Solanum tuberosum] Length = 767 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +S+VD+GAH+ATDSLHRID Sbjct: 319 FSPDGKFLVFLSSKSAVDSGAHNATDSLHRID 350 >ref|XP_006362171.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Solanum tuberosum] gi|565392998|ref|XP_006362172.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Solanum tuberosum] Length = 768 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +S+VD+GAH+ATDSLHRID Sbjct: 320 FSPDGKFLVFLSSKSAVDSGAHNATDSLHRID 351 >ref|XP_007225244.1| hypothetical protein PRUPE_ppa001729mg [Prunus persica] gi|462422180|gb|EMJ26443.1| hypothetical protein PRUPE_ppa001729mg [Prunus persica] Length = 773 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFL FLS +SSVD+GAHSATDSLHRID Sbjct: 325 FSPDGKFLSFLSARSSVDSGAHSATDSLHRID 356 >ref|XP_004247631.1| PREDICTED: acylamino-acid-releasing enzyme-like [Solanum lycopersicum] Length = 768 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +S+VD+GAH+ATDSLHRID Sbjct: 320 FSPDGKFLVFLSSKSAVDSGAHNATDSLHRID 351 >ref|XP_003637575.1| Acylamino-acid-releasing enzyme [Medicago truncatula] gi|355503510|gb|AES84713.1| Acylamino-acid-releasing enzyme [Medicago truncatula] Length = 607 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDG FLVFLS +SSVDTGAHSAT+SLHRID Sbjct: 159 FSPDGNFLVFLSARSSVDTGAHSATNSLHRID 190 >ref|XP_002284013.2| PREDICTED: acylamino-acid-releasing enzyme-like isoform 1 [Vitis vinifera] gi|297737147|emb|CBI26348.3| unnamed protein product [Vitis vinifera] Length = 822 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRI 5 +SPDGKFLVFLS +SSVD+GAHSATDSLHRI Sbjct: 375 FSPDGKFLVFLSAKSSVDSGAHSATDSLHRI 405 >gb|EYU33017.1| hypothetical protein MIMGU_mgv1a001397mg [Mimulus guttatus] Length = 825 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +SSVD+GAHSATDSLH+I+ Sbjct: 377 FSPDGKFLVFLSAKSSVDSGAHSATDSLHKIE 408 >gb|EYU33016.1| hypothetical protein MIMGU_mgv1a001397mg [Mimulus guttatus] Length = 826 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVFLS +SSVD+GAHSATDSLH+I+ Sbjct: 378 FSPDGKFLVFLSAKSSVDSGAHSATDSLHKIE 409 >ref|XP_003536827.2| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Glycine max] Length = 826 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVF+S +SSVD+G HSATDSLHRID Sbjct: 378 FSPDGKFLVFVSARSSVDSGVHSATDSLHRID 409 >ref|XP_006588524.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Glycine max] Length = 827 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 97 YSPDGKFLVFLSFQSSVDTGAHSATDSLHRID 2 +SPDGKFLVF+S +SSVD+G HSATDSLHRID Sbjct: 379 FSPDGKFLVFVSARSSVDSGVHSATDSLHRID 410