BLASTX nr result
ID: Akebia25_contig00055297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055297 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71183.1| hypothetical protein VITISV_033416 [Vitis vinifera] 56 6e-06 >emb|CAN71183.1| hypothetical protein VITISV_033416 [Vitis vinifera] Length = 1255 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 165 FSMSNWSLSNAPIVKGDKFNLNQCPKNDLENEQM 64 F M N S S +PIVKGD+FNLNQCPKNDLE EQM Sbjct: 1159 FRMKNCSPSVSPIVKGDRFNLNQCPKNDLEMEQM 1192