BLASTX nr result
ID: Akebia25_contig00055226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055226 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG13313.1| hypothetical protein MPH_09595 [Macrophomina phas... 58 1e-06 >gb|EKG13313.1| hypothetical protein MPH_09595 [Macrophomina phaseolina MS6] Length = 522 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/87 (35%), Positives = 52/87 (59%), Gaps = 3/87 (3%) Frame = +2 Query: 2 RFNPQSSSKDFHEFLNELEEAGACEKEGGDVDWLESLLKSSNEETQTRAYAIQRAADARE 181 RF P + +D F+ LEE +GG +DWL++L +S + + +T AY I++A AR+ Sbjct: 54 RFTPDIALQDHKVFVQSLEEVER-HGQGGPLDWLDALAQSDDGDRRTGAYIIRQAERARD 112 Query: 182 KIDYRR---KSVEFANGVKIWAGKSAD 253 ++ Y+R ++ A GVKIW ++ D Sbjct: 113 QLRYQRPLQSPLKEAEGVKIWNSRTGD 139