BLASTX nr result
ID: Akebia25_contig00055198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055198 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD01137.1| hypothetical protein BAUCODRAFT_62407 [Baudoinia ... 55 8e-06 >gb|EMD01137.1| hypothetical protein BAUCODRAFT_62407 [Baudoinia compniacensis UAMH 10762] Length = 456 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/74 (45%), Positives = 43/74 (58%), Gaps = 5/74 (6%) Frame = +2 Query: 17 QYHNPQQLTPHSQDEPASYPVSSTQQTDVLDASYGNLA--HMIDPE--MLDADPFGLTAS 184 Q+HN QL Q P S ++ T Q + + G + +ID +LDADPFGL+AS Sbjct: 382 QFHNMTQL--QQQQHPGSSRIAPTSQPESSGFASGRMVMGQLIDAHDPLLDADPFGLSAS 439 Query: 185 MHYSTTYG-YGQQP 223 MHY TTYG GQQP Sbjct: 440 MHYPTTYGTIGQQP 453