BLASTX nr result
ID: Akebia25_contig00055186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055186 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC91144.1| hypothetical protein BAUCODRAFT_39287 [Baudoinia ... 60 4e-07 >gb|EMC91144.1| hypothetical protein BAUCODRAFT_39287 [Baudoinia compniacensis UAMH 10762] Length = 459 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/53 (60%), Positives = 36/53 (67%), Gaps = 12/53 (22%) Frame = -1 Query: 142 GLYSQPSNSSLAVGVNGRP------------SRDGLAGSRAPSAYLEGLFENH 20 GLY+QPS+SSL VGV G+ SRDGLAG RAPSAYLE +FENH Sbjct: 399 GLYAQPSSSSLMVGVGGQAGAGLNVRKTRESSRDGLAGGRAPSAYLEEMFENH 451