BLASTX nr result
ID: Akebia25_contig00055171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00055171 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC98922.1| hypothetical protein BAUCODRAFT_385071 [Baudoinia... 78 1e-12 gb|EME46514.1| hypothetical protein DOTSEDRAFT_61143 [Dothistrom... 77 3e-12 gb|EMF13956.1| hypothetical protein SEPMUDRAFT_40409 [Sphaerulin... 72 8e-11 gb|EME83576.1| hypothetical protein MYCFIDRAFT_211371 [Pseudocer... 71 1e-10 ref|XP_003853506.1| hypothetical protein MYCGRDRAFT_39970, parti... 70 3e-10 gb|EON67113.1| hypothetical protein W97_06366 [Coniosporium apol... 70 4e-10 ref|XP_001935049.1| conserved hypothetical protein [Pyrenophora ... 69 7e-10 gb|EOA91433.1| hypothetical protein SETTUDRAFT_85840 [Setosphaer... 68 2e-09 ref|XP_001804409.1| hypothetical protein SNOG_14212 [Phaeosphaer... 67 3e-09 ref|XP_003299248.1| hypothetical protein PTT_10198 [Pyrenophora ... 66 4e-09 gb|EUC33475.1| hypothetical protein COCCADRAFT_95942 [Bipolaris ... 65 1e-08 gb|EMD86958.1| hypothetical protein COCHEDRAFT_1023727 [Bipolari... 65 1e-08 gb|EMD59680.1| hypothetical protein COCSADRAFT_40850 [Bipolaris ... 65 1e-08 gb|EUC41108.1| hypothetical protein COCMIDRAFT_40656 [Bipolaris ... 64 2e-08 gb|EUN22330.1| hypothetical protein COCVIDRAFT_111685 [Bipolaris... 62 1e-07 ref|XP_007291290.1| hypothetical protein MBM_03401 [Marssonina b... 59 9e-07 gb|ETN46851.1| hypothetical protein HMPREF1541_01040 [Cyphelloph... 56 6e-06 >gb|EMC98922.1| hypothetical protein BAUCODRAFT_385071 [Baudoinia compniacensis UAMH 10762] Length = 125 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 SLNVFKKPLALHST+PMTG+LRNGYCEVPA+DFGNHS Sbjct: 4 SLNVFKKPLALHSTNPMTGYLRNGYCEVPASDFGNHS 40 >gb|EME46514.1| hypothetical protein DOTSEDRAFT_61143 [Dothistroma septosporum NZE10] Length = 124 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 SLNVFK+PLALHSTSPMTG+LRNGYCEVPA+DFGNH+ Sbjct: 4 SLNVFKQPLALHSTSPMTGYLRNGYCEVPASDFGNHA 40 >gb|EMF13956.1| hypothetical protein SEPMUDRAFT_40409 [Sphaerulina musiva SO2202] Length = 125 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNH 241 SLNVFK+PL LHSTSPMTG+LRNGYCEVP +D+GNH Sbjct: 4 SLNVFKQPLTLHSTSPMTGYLRNGYCEVPGSDYGNH 39 >gb|EME83576.1| hypothetical protein MYCFIDRAFT_211371 [Pseudocercospora fijiensis CIRAD86] Length = 166 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 SLNVFK+PL LHSTSP+TG+LR GYCEVPA+DFGNH+ Sbjct: 4 SLNVFKQPLTLHSTSPITGYLRTGYCEVPASDFGNHA 40 >ref|XP_003853506.1| hypothetical protein MYCGRDRAFT_39970, partial [Zymoseptoria tritici IPO323] gi|339473388|gb|EGP88482.1| hypothetical protein MYCGRDRAFT_39970 [Zymoseptoria tritici IPO323] Length = 119 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/34 (85%), Positives = 34/34 (100%) Frame = +2 Query: 143 VFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 VFK+PL+LHSTSPMTGFLRNGYCEVP++DFGNH+ Sbjct: 1 VFKQPLSLHSTSPMTGFLRNGYCEVPSSDFGNHA 34 >gb|EON67113.1| hypothetical protein W97_06366 [Coniosporium apollinis CBS 100218] Length = 122 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 SLNVFKKPLALHST PMTG+ RNGYCEVP D GNHS Sbjct: 3 SLNVFKKPLALHSTKPMTGYTRNGYCEVPPEDGGNHS 39 >ref|XP_001935049.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980997|gb|EDU47623.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 167 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 SLNVFK+PLALHST P+TGF R GYCEVPA+D GNHS Sbjct: 49 SLNVFKQPLALHSTQPLTGFTRTGYCEVPASDAGNHS 85 >gb|EOA91433.1| hypothetical protein SETTUDRAFT_85840 [Setosphaeria turcica Et28A] Length = 165 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +2 Query: 122 PSPNSLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 P+ SLNVFK+PLALHST P+TGF R GYCEVP +D GNH+ Sbjct: 43 PATMSLNVFKQPLALHSTQPLTGFTRTGYCEVPPSDAGNHA 83 >ref|XP_001804409.1| hypothetical protein SNOG_14212 [Phaeosphaeria nodorum SN15] gi|111057329|gb|EAT78449.1| hypothetical protein SNOG_14212 [Phaeosphaeria nodorum SN15] Length = 161 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 SLNVFK+PLALHST P+TGF+R GYCE P D GNHS Sbjct: 43 SLNVFKQPLALHSTKPLTGFMRTGYCEAPKQDLGNHS 79 >ref|XP_003299248.1| hypothetical protein PTT_10198 [Pyrenophora teres f. teres 0-1] gi|311327167|gb|EFQ92666.1| hypothetical protein PTT_10198 [Pyrenophora teres f. teres 0-1] Length = 166 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 S NVFK+PLALHST P+TGF R GYCEVPA+D GNH+ Sbjct: 48 SFNVFKQPLALHSTQPLTGFTRTGYCEVPASDAGNHA 84 >gb|EUC33475.1| hypothetical protein COCCADRAFT_95942 [Bipolaris zeicola 26-R-13] Length = 165 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 +LNVFK+PLALHST P+TGF R GYCEVP +D GNH+ Sbjct: 47 ALNVFKQPLALHSTQPLTGFTRTGYCEVPPSDAGNHA 83 >gb|EMD86958.1| hypothetical protein COCHEDRAFT_1023727 [Bipolaris maydis C5] gi|477586963|gb|ENI04046.1| hypothetical protein COCC4DRAFT_171808 [Bipolaris maydis ATCC 48331] Length = 164 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 +LNVFK+PLALHST P+TGF R GYCEVP +D GNH+ Sbjct: 46 ALNVFKQPLALHSTQPLTGFTRTGYCEVPPSDAGNHA 82 >gb|EMD59680.1| hypothetical protein COCSADRAFT_40850 [Bipolaris sorokiniana ND90Pr] Length = 169 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 +LNVFK+PLALHST P+TGF R GYCEVP +D GNH+ Sbjct: 51 ALNVFKQPLALHSTQPLTGFTRTGYCEVPPSDAGNHA 87 >gb|EUC41108.1| hypothetical protein COCMIDRAFT_40656 [Bipolaris oryzae ATCC 44560] Length = 159 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 +LNVFK+PLALHST P+TGF R GYCEVP +D GNH+ Sbjct: 41 ALNVFKQPLALHSTQPITGFTRTGYCEVPPSDAGNHA 77 >gb|EUN22330.1| hypothetical protein COCVIDRAFT_111685 [Bipolaris victoriae FI3] Length = 165 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 +LNVFK+PLALHST P+TGF R YCEVP +D GNH+ Sbjct: 47 ALNVFKQPLALHSTQPLTGFTRTEYCEVPPSDAGNHA 83 >ref|XP_007291290.1| hypothetical protein MBM_03401 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406865366|gb|EKD18408.1| hypothetical protein MBM_03401 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 167 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = +2 Query: 134 SLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 SLNVFKKPL L S PMTGF RNG+CEV D GNHS Sbjct: 11 SLNVFKKPLGLFSKEPMTGFYRNGFCEVGPDDQGNHS 47 >gb|ETN46851.1| hypothetical protein HMPREF1541_01040 [Cyphellophora europaea CBS 101466] Length = 170 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = +2 Query: 119 MPSPNSLNVFKKPLALHSTSPMTGFLRNGYCEVPATDFGNHS 244 M + N LNVF++PL L S P TGF R+GYC A DFGNH+ Sbjct: 36 MSASNPLNVFRQPLQLFSMQPRTGFYRDGYCRTGAADFGNHA 77