BLASTX nr result
ID: Akebia25_contig00054970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00054970 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004504032.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_002276540.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_003524280.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006585305.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_004296690.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 gb|EXB80843.1| hypothetical protein L484_020101 [Morus notabilis] 59 9e-07 ref|XP_006428072.1| hypothetical protein CICLE_v10025440mg [Citr... 57 3e-06 ref|XP_004953934.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_004953933.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_004237613.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_002532046.1| pentatricopeptide repeat-containing protein,... 57 3e-06 ref|XP_007212021.1| hypothetical protein PRUPE_ppa004899mg [Prun... 56 5e-06 ref|XP_003630096.1| Pentatricopeptide repeat-containing protein ... 56 6e-06 ref|NP_001190970.1| pentatricopeptide repeat-containing protein ... 56 6e-06 ref|NP_195672.1| pentatricopeptide repeat-containing protein [Ar... 56 6e-06 gb|EYU31068.1| hypothetical protein MIMGU_mgv1a024034mg [Mimulus... 55 8e-06 >ref|XP_004504032.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X1 [Cicer arietinum] gi|502140047|ref|XP_004504033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X2 [Cicer arietinum] Length = 477 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/53 (62%), Positives = 38/53 (71%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNNREARSANSQGRAKT 159 LL KLLK+MDKDG++PNK+FFL+ALGA GSS S S N S N Q AKT Sbjct: 421 LLDKLLKHMDKDGVIPNKRFFLDALGAIGSSTEKSGSANAGTDSKNPQKFAKT 473 >ref|XP_002276540.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Vitis vinifera] gi|296082481|emb|CBI21486.3| unnamed protein product [Vitis vinifera] Length = 489 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNNREARSANSQGRAKT 159 LL+KLLK MD DGI+PNK+FFLEALGAFGSS A ES + AKT Sbjct: 437 LLEKLLKLMDSDGILPNKRFFLEALGAFGSSPASQESAGSTTGLTRPRNSAKT 489 >ref|XP_003524280.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Glycine max] Length = 503 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNN--REARSANSQ 144 LL KLLK+MDKDGIVPNK+FFL+ALGA S A SES N ++++ANS+ Sbjct: 412 LLDKLLKHMDKDGIVPNKRFFLDALGAVASLPANSESANAATDSKTANSE 461 >ref|XP_006585305.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Glycine max] Length = 526 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNN--REARSANSQ 144 LL KLLK+MDKDGI+PNK+FFL+ALGA S A SES N ++ +ANS+ Sbjct: 421 LLDKLLKHMDKDGIIPNKRFFLDALGAVASLPANSESANAATDSNTANSE 470 >ref|XP_004296690.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 420 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNN 117 LL KLLK MDKDGIVPNK+FFLEALGAF SS SES + Sbjct: 367 LLDKLLKSMDKDGIVPNKRFFLEALGAFLSSTGNSESGS 405 >gb|EXB80843.1| hypothetical protein L484_020101 [Morus notabilis] Length = 485 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNNREARSANSQGRAKT 159 LL LL++M+KDGIVPNK+FFLEALGAF SS A S + A S+ + KT Sbjct: 433 LLGNLLRHMEKDGIVPNKRFFLEALGAFCSSNASPVSMSATAASSRPENSVKT 485 >ref|XP_006428072.1| hypothetical protein CICLE_v10025440mg [Citrus clementina] gi|568819570|ref|XP_006464322.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Citrus sinensis] gi|557530062|gb|ESR41312.1| hypothetical protein CICLE_v10025440mg [Citrus clementina] Length = 500 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNNREARSANSQGRAKT 159 L+QKLLK M+++GIVPNK+FFLEAL F SS AGS+S + + S AK+ Sbjct: 448 LVQKLLKRMEQNGIVPNKRFFLEALETFSSSLAGSQSGSAKTDLTRSLSTAKS 500 >ref|XP_004953934.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X2 [Setaria italica] Length = 500 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/57 (54%), Positives = 41/57 (71%), Gaps = 4/57 (7%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSS----RAGSESNNREARSANSQGRAKT 159 L+QKLLK M+K GIVPNKKFFL+AL AFG+S R S +N+ S++S G ++T Sbjct: 428 LVQKLLKRMNKQGIVPNKKFFLDALEAFGTSERKPRTSSATNSASKPSSDSAGDSET 484 >ref|XP_004953933.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X1 [Setaria italica] Length = 511 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/57 (54%), Positives = 41/57 (71%), Gaps = 4/57 (7%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSS----RAGSESNNREARSANSQGRAKT 159 L+QKLLK M+K GIVPNKKFFL+AL AFG+S R S +N+ S++S G ++T Sbjct: 428 LVQKLLKRMNKQGIVPNKKFFLDALEAFGTSERKPRTSSATNSASKPSSDSAGDSQT 484 >ref|XP_004237613.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Solanum lycopersicum] Length = 478 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSS 93 L+QKLL YMD+DGI+PNKKFFL+ALGAFGS+ Sbjct: 428 LVQKLLTYMDEDGIIPNKKFFLDALGAFGSA 458 >ref|XP_002532046.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528289|gb|EEF30336.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 478 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNNREARS 132 L+QKLLK+MD+DGI+PNK+FFL+ALGAF S A S + A++ Sbjct: 435 LVQKLLKHMDRDGIIPNKRFFLDALGAFKSLPASSGNQQNNAKT 478 >ref|XP_007212021.1| hypothetical protein PRUPE_ppa004899mg [Prunus persica] gi|462407886|gb|EMJ13220.1| hypothetical protein PRUPE_ppa004899mg [Prunus persica] Length = 486 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/53 (58%), Positives = 34/53 (64%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNNREARSANSQGRAKT 159 LL+KLLK MDKDGIVPNK+FFLEALGAF SS S + Q KT Sbjct: 434 LLEKLLKCMDKDGIVPNKRFFLEALGAFFSSPGSPGSVTATTGLSRPQDGTKT 486 >ref|XP_003630096.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524118|gb|AET04572.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 635 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNNREARSANSQ 144 LL KLLK MDKD ++PNK+FFL+ALGA GSS S S N S+ Q Sbjct: 420 LLDKLLKQMDKDSVIPNKRFFLDALGAIGSSTEKSGSANAGTGSSRPQ 467 >ref|NP_001190970.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332661695|gb|AEE87095.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 510 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +1 Query: 4 LQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNNREA-RSANSQGRAK 156 +Q L+K M+KDGIVPNK+FFLEAL FGS GS S NR++ RS+ S+ K Sbjct: 437 VQILMKKMEKDGIVPNKRFFLEALEVFGSRLPGSGSENRKSTRSSRSRDSPK 488 >ref|NP_195672.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75266408|sp|Q9SV96.1|PP358_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g39620, chloroplastic; AltName: Full=Protein EMBRYO DEFECTIVE 2453; Flags: Precursor gi|5042178|emb|CAB44697.1| putative protein [Arabidopsis thaliana] gi|7270946|emb|CAB80625.1| putative protein [Arabidopsis thaliana] gi|58013022|gb|AAW62964.1| chloroplast embryo-defective 2453 [Arabidopsis thaliana] gi|332661694|gb|AEE87094.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 563 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +1 Query: 4 LQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNNREA-RSANSQGRAK 156 +Q L+K M+KDGIVPNK+FFLEAL FGS GS S NR++ RS+ S+ K Sbjct: 437 VQILMKKMEKDGIVPNKRFFLEALEVFGSRLPGSGSENRKSTRSSRSRDSPK 488 >gb|EYU31068.1| hypothetical protein MIMGU_mgv1a024034mg [Mimulus guttatus] Length = 496 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +1 Query: 1 LLQKLLKYMDKDGIVPNKKFFLEALGAFGSSRAGSESNNRE 123 LL KL+ MDKDGI+PNK+FFL+ALGA GS G +S NR+ Sbjct: 442 LLGKLVVCMDKDGIIPNKRFFLDALGAIGSFHDGKKSTNRK 482