BLASTX nr result
ID: Akebia25_contig00054947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00054947 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300417.2| hypothetical protein POPTR_0001s32460g [Popu... 59 9e-07 >ref|XP_002300417.2| hypothetical protein POPTR_0001s32460g [Populus trichocarpa] gi|550348710|gb|EEE85222.2| hypothetical protein POPTR_0001s32460g [Populus trichocarpa] Length = 2650 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/61 (54%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = -1 Query: 308 RVSTCPYPSADEEMVRIGLKMETGSQPSPVSGSLRYKKRKRRKFGAQS-ADAPYSHKLPQ 132 RVS+CPYPSA EEM R+GLK ETGSQ SP GS R K+ R F + DA ++ +P Sbjct: 438 RVSSCPYPSATEEMSRLGLKGETGSQFSPDCGSSRPKESNRSFFKKRKLEDASWNVSVPS 497 Query: 131 K 129 K Sbjct: 498 K 498