BLASTX nr result
ID: Akebia25_contig00054790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00054790 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME48691.1| hypothetical protein DOTSEDRAFT_67657 [Dothistrom... 77 3e-12 gb|EMC96494.1| hypothetical protein BAUCODRAFT_70359 [Baudoinia ... 73 5e-11 gb|EMF17076.1| hypothetical protein SEPMUDRAFT_146171 [Sphaeruli... 65 1e-08 gb|EME88236.1| hypothetical protein MYCFIDRAFT_124602, partial [... 65 1e-08 ref|XP_003856651.1| hypothetical protein MYCGRDRAFT_54115, parti... 62 6e-08 gb|EMD69302.1| hypothetical protein COCSADRAFT_32047 [Bipolaris ... 59 7e-07 gb|EOA90793.1| hypothetical protein SETTUDRAFT_166685 [Setosphae... 59 9e-07 gb|EMD95960.1| hypothetical protein COCHEDRAFT_1019459 [Bipolari... 58 2e-06 gb|EUC35894.1| hypothetical protein COCCADRAFT_34620 [Bipolaris ... 57 2e-06 gb|EUC50432.1| hypothetical protein COCMIDRAFT_82145 [Bipolaris ... 56 5e-06 >gb|EME48691.1| hypothetical protein DOTSEDRAFT_67657 [Dothistroma septosporum NZE10] Length = 288 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +2 Query: 143 MGIVKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADR 265 MGI KGGALRLFQTFLYALEFCCAA+ +G++SYFL+VLADR Sbjct: 1 MGIFKGGALRLFQTFLYALEFCCAAVCIGVFSYFLAVLADR 41 >gb|EMC96494.1| hypothetical protein BAUCODRAFT_70359 [Baudoinia compniacensis UAMH 10762] Length = 305 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +2 Query: 143 MGIVKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADR 265 MGIVKGGALRL Q+ LYA+EF CAAIILGIYSYFLSVLADR Sbjct: 1 MGIVKGGALRLLQSGLYAIEFLCAAIILGIYSYFLSVLADR 41 >gb|EMF17076.1| hypothetical protein SEPMUDRAFT_146171 [Sphaerulina musiva SO2202] Length = 282 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 143 MGIVKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADR 265 M ++KGG LRLFQTFLY L F CAA+IL IYSYFL+ LADR Sbjct: 1 MALIKGGFLRLFQTFLYLLAFLCAALILAIYSYFLATLADR 41 >gb|EME88236.1| hypothetical protein MYCFIDRAFT_124602, partial [Pseudocercospora fijiensis CIRAD86] Length = 277 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +2 Query: 152 VKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADR 265 +KGGALRLFQT LYAL F C+A+ LGIYSYFL+VLADR Sbjct: 1 IKGGALRLFQTLLYALAFGCSAVALGIYSYFLAVLADR 38 >ref|XP_003856651.1| hypothetical protein MYCGRDRAFT_54115, partial [Zymoseptoria tritici IPO323] gi|339476536|gb|EGP91627.1| hypothetical protein MYCGRDRAFT_54115 [Zymoseptoria tritici IPO323] Length = 283 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +2 Query: 143 MGIVKGGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADR 265 MG++KGG +R+ QTF+Y L F C+A+ LGIY+YFLSVLADR Sbjct: 1 MGLIKGGFMRVTQTFIYFLAFLCSAVALGIYAYFLSVLADR 41 >gb|EMD69302.1| hypothetical protein COCSADRAFT_32047 [Bipolaris sorokiniana ND90Pr] Length = 288 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +2 Query: 158 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADR 265 G AL+ T +YALEFCCAAIILGIYSYFLSV ADR Sbjct: 5 GAALKFGSTAIYALEFCCAAIILGIYSYFLSVQADR 40 >gb|EOA90793.1| hypothetical protein SETTUDRAFT_166685 [Setosphaeria turcica Et28A] Length = 288 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +2 Query: 158 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADR 265 G AL+ T LYALEFCCAAIILGIYSYFL+V ADR Sbjct: 5 GAALKFGSTALYALEFCCAAIILGIYSYFLAVQADR 40 >gb|EMD95960.1| hypothetical protein COCHEDRAFT_1019459 [Bipolaris maydis C5] gi|477593750|gb|ENI10819.1| hypothetical protein COCC4DRAFT_35709 [Bipolaris maydis ATCC 48331] Length = 288 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 158 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADR 265 G AL+ T +YALEFCCAAIILGIYSYFL+V ADR Sbjct: 5 GAALKFGSTAIYALEFCCAAIILGIYSYFLAVQADR 40 >gb|EUC35894.1| hypothetical protein COCCADRAFT_34620 [Bipolaris zeicola 26-R-13] gi|578493228|gb|EUN30622.1| hypothetical protein COCVIDRAFT_13025 [Bipolaris victoriae FI3] Length = 288 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 158 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADR 265 G AL+ T +YALEFCCAAI+LGIYSYFL+V ADR Sbjct: 5 GAALKFGSTAIYALEFCCAAIVLGIYSYFLAVQADR 40 >gb|EUC50432.1| hypothetical protein COCMIDRAFT_82145 [Bipolaris oryzae ATCC 44560] Length = 288 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +2 Query: 158 GGALRLFQTFLYALEFCCAAIILGIYSYFLSVLADR 265 G AL+ T +Y LEFCCAAIILGIYSYFL+V ADR Sbjct: 5 GAALKFGSTAIYTLEFCCAAIILGIYSYFLAVQADR 40