BLASTX nr result
ID: Akebia25_contig00054582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00054582 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC99492.1| hypothetical protein BAUCODRAFT_144905 [Baudoinia... 55 1e-05 >gb|EMC99492.1| hypothetical protein BAUCODRAFT_144905 [Baudoinia compniacensis UAMH 10762] Length = 562 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/78 (41%), Positives = 42/78 (53%), Gaps = 2/78 (2%) Frame = +2 Query: 5 DVLKQLFPDMELDNGDAPPSPRTQADTMYVVKSGGYPDDPAIVGIFDDRPQARAM--SGQ 178 DVL+QLFPDM+L NG +P + D + P + D P ++ + Q Sbjct: 468 DVLQQLFPDMDL-NGGYFNTPSSSQDFAVATSNATASAAPTSLASMDFGPMDESIGFTSQ 526 Query: 179 AWSDGSMSIPNDAYTAPY 232 AWSDGSMSIPND + PY Sbjct: 527 AWSDGSMSIPNDDFANPY 544