BLASTX nr result
ID: Akebia25_contig00054216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00054216 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME79794.1| hypothetical protein MYCFIDRAFT_98814, partial [P... 56 6e-06 >gb|EME79794.1| hypothetical protein MYCFIDRAFT_98814, partial [Pseudocercospora fijiensis CIRAD86] Length = 430 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/84 (41%), Positives = 49/84 (58%), Gaps = 14/84 (16%) Frame = +2 Query: 125 GNTVKGENPL-----SDDIADMVEKSKQGEKEPVVRGDGTQLKQ-SDAPRNPKKRTFEV- 283 G K +NP+ S+DI M E+S + ++PV RGDGT L++ D P+NPKK+TFE Sbjct: 347 GAGAKVQNPILQGKVSEDIGKMAEQSAKQNEQPVKRGDGTVLQERGDVPKNPKKKTFEAE 406 Query: 284 ----KPEEVEQQQMSPD---KDEL 334 K EE +QQ + +DEL Sbjct: 407 VEDEKHEEAQQQGQQKEGQKRDEL 430