BLASTX nr result
ID: Akebia25_contig00054109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00054109 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002626401.1| conserved hypothetical protein [Ajellomyces ... 107 1e-21 ref|XP_001544670.1| conserved hypothetical protein [Ajellomyces ... 107 2e-21 gb|EPS35492.1| hypothetical protein H072_11096 [Dactylellina hap... 106 3e-21 gb|EER39660.1| conserved hypothetical protein [Ajellomyces capsu... 106 4e-21 gb|EAS31743.2| hypothetical protein CIMG_06890 [Coccidioides imm... 105 5e-21 emb|CCD44442.1| hypothetical protein BofuT4_P053430.1 [Botryotin... 105 5e-21 ref|XP_003070094.1| hypothetical protein CPC735_032850 [Coccidio... 105 5e-21 ref|XP_002794521.1| conserved hypothetical protein [Paracoccidio... 105 5e-21 ref|XP_001242994.1| hypothetical protein CIMG_06890 [Coccidioide... 105 5e-21 gb|ESZ98477.1| hypothetical protein SBOR_1139 [Sclerotinia borea... 104 1e-20 gb|EXJ60424.1| hypothetical protein A1O7_04576 [Cladophialophora... 104 1e-20 dbj|GAD95037.1| hypothetical protein CPC735_032850 [Byssochlamys... 104 1e-20 gb|ETI24743.1| hypothetical protein G647_04113 [Cladophialophora... 103 3e-20 ref|XP_002544084.1| conserved hypothetical protein [Uncinocarpus... 102 4e-20 ref|XP_752609.1| conserved hypothetical protein [Aspergillus fum... 102 6e-20 ref|XP_001264522.1| hypothetical protein NFIA_013140 [Neosartory... 102 6e-20 gb|ERF77093.1| hypothetical protein EPUS_06311 [Endocarpon pusil... 102 7e-20 gb|EMD87219.1| hypothetical protein COCHEDRAFT_1206513 [Bipolari... 101 1e-19 gb|ETN44636.1| hypothetical protein HMPREF1541_10306 [Cyphelloph... 100 2e-19 ref|XP_007293004.1| hypothetical protein MBM_05115 [Marssonina b... 100 2e-19 >ref|XP_002626401.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] gi|239594609|gb|EEQ77190.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] gi|239607999|gb|EEQ84986.1| conserved hypothetical protein [Ajellomyces dermatitidis ER-3] gi|327358020|gb|EGE86877.1| hypothetical protein BDDG_09828 [Ajellomyces dermatitidis ATCC 18188] gi|531985164|gb|EQL35751.1| hypothetical protein BDFG_02681 [Ajellomyces dermatitidis ATCC 26199] Length = 367 Score = 107 bits (268), Expect = 1e-21 Identities = 49/70 (70%), Positives = 56/70 (80%) Frame = +1 Query: 25 EEVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRH 204 +E++TG V LNLPL+VP+ PGFGRE F HSIK L GIAYDD Y LNTQSG+QWDGFRH Sbjct: 75 DEIKTGEIVPLNLPLNVPEQPGFGREKFVHSIKALVPGIAYDDNYQLNTQSGTQWDGFRH 134 Query: 205 MSHSPTQTFY 234 +H TQTFY Sbjct: 135 FAHIATQTFY 144 >ref|XP_001544670.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] gi|150408311|gb|EDN03852.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] Length = 354 Score = 107 bits (267), Expect = 2e-21 Identities = 49/70 (70%), Positives = 56/70 (80%) Frame = +1 Query: 25 EEVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRH 204 +E+RTG V LNLPL+VP+ PGFGRE F HSIK L GIAYDD Y LNTQSG+QWDGFRH Sbjct: 75 DEIRTGEVVPLNLPLNVPEQPGFGREKFVHSIKTLIPGIAYDDNYQLNTQSGTQWDGFRH 134 Query: 205 MSHSPTQTFY 234 +H +QTFY Sbjct: 135 FAHISSQTFY 144 >gb|EPS35492.1| hypothetical protein H072_11096 [Dactylellina haptotyla CBS 200.50] Length = 357 Score = 106 bits (265), Expect = 3e-21 Identities = 45/69 (65%), Positives = 56/69 (81%) Frame = +1 Query: 28 EVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRHM 207 E+RTG + +NLPL+VP+ P FGRE F H+IK L+ G+A+DDLY LNTQSG+QWDGFRH Sbjct: 77 EIRTGELIPVNLPLNVPEQPSFGRETFQHTIKSLHDGVAFDDLYHLNTQSGTQWDGFRHF 136 Query: 208 SHSPTQTFY 234 SH +QTFY Sbjct: 137 SHLSSQTFY 145 >gb|EER39660.1| conserved hypothetical protein [Ajellomyces capsulatus H143] Length = 337 Score = 106 bits (264), Expect = 4e-21 Identities = 48/70 (68%), Positives = 56/70 (80%) Frame = +1 Query: 25 EEVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRH 204 +E++TG V LNLPL+VP+ PGFGRE F HSIK L GIAYDD Y LNTQSG+QWDGFRH Sbjct: 78 DEIKTGEIVPLNLPLNVPEQPGFGREKFVHSIKTLIPGIAYDDNYQLNTQSGTQWDGFRH 137 Query: 205 MSHSPTQTFY 234 +H +QTFY Sbjct: 138 FAHISSQTFY 147 >gb|EAS31743.2| hypothetical protein CIMG_06890 [Coccidioides immitis RS] Length = 361 Score = 105 bits (263), Expect = 5e-21 Identities = 47/69 (68%), Positives = 55/69 (79%) Frame = +1 Query: 28 EVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRHM 207 E++TG V LNLPL+VP+ P FGRE F H+IK L IAYDD Y+LNTQSG+QWDGFRH Sbjct: 76 EIKTGELVPLNLPLNVPETPAFGREKFVHTIKTLTENIAYDDKYELNTQSGTQWDGFRHF 135 Query: 208 SHSPTQTFY 234 +H PTQTFY Sbjct: 136 AHLPTQTFY 144 >emb|CCD44442.1| hypothetical protein BofuT4_P053430.1 [Botryotinia fuckeliana T4] gi|472244120|gb|EMR88749.1| hypothetical protein BcDW1_2607 [Botryotinia fuckeliana BcDW1] Length = 370 Score = 105 bits (263), Expect = 5e-21 Identities = 46/69 (66%), Positives = 56/69 (81%) Frame = +1 Query: 28 EVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRHM 207 E+++G V LNLPL+VP+ P F REPF HSIKEL G+AYDD+Y LNTQSG+QWDGFRH+ Sbjct: 80 EIQSGEIVPLNLPLNVPEIPAFAREPFEHSIKELAPGLAYDDIYSLNTQSGTQWDGFRHI 139 Query: 208 SHSPTQTFY 234 +H PT FY Sbjct: 140 AHMPTGKFY 148 >ref|XP_003070094.1| hypothetical protein CPC735_032850 [Coccidioides posadasii C735 delta SOWgp] gi|240109780|gb|EER27949.1| hypothetical protein CPC735_032850 [Coccidioides posadasii C735 delta SOWgp] gi|320031940|gb|EFW13897.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] Length = 361 Score = 105 bits (263), Expect = 5e-21 Identities = 47/69 (68%), Positives = 55/69 (79%) Frame = +1 Query: 28 EVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRHM 207 E++TG V LNLPL+VP+ P FGRE F H+IK L IAYDD Y+LNTQSG+QWDGFRH Sbjct: 76 EIKTGELVPLNLPLNVPETPAFGREKFVHTIKTLTENIAYDDKYELNTQSGTQWDGFRHF 135 Query: 208 SHSPTQTFY 234 +H PTQTFY Sbjct: 136 AHLPTQTFY 144 >ref|XP_002794521.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] gi|226285937|gb|EEH41503.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 369 Score = 105 bits (263), Expect = 5e-21 Identities = 47/70 (67%), Positives = 57/70 (81%) Frame = +1 Query: 25 EEVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRH 204 EE++TG V L+LPL+VP+ PGFGRE F H+IK L GIAYDD Y+LNTQSG+QWDGFRH Sbjct: 75 EEIKTGEIVPLDLPLNVPEQPGFGREKFVHTIKALVPGIAYDDKYELNTQSGTQWDGFRH 134 Query: 205 MSHSPTQTFY 234 +H +QTFY Sbjct: 135 FAHRASQTFY 144 >ref|XP_001242994.1| hypothetical protein CIMG_06890 [Coccidioides immitis RS] Length = 369 Score = 105 bits (263), Expect = 5e-21 Identities = 47/69 (68%), Positives = 55/69 (79%) Frame = +1 Query: 28 EVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRHM 207 E++TG V LNLPL+VP+ P FGRE F H+IK L IAYDD Y+LNTQSG+QWDGFRH Sbjct: 84 EIKTGELVPLNLPLNVPETPAFGREKFVHTIKTLTENIAYDDKYELNTQSGTQWDGFRHF 143 Query: 208 SHSPTQTFY 234 +H PTQTFY Sbjct: 144 AHLPTQTFY 152 >gb|ESZ98477.1| hypothetical protein SBOR_1139 [Sclerotinia borealis F-4157] Length = 365 Score = 104 bits (260), Expect = 1e-20 Identities = 46/69 (66%), Positives = 56/69 (81%) Frame = +1 Query: 28 EVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRHM 207 E+++G V LNLPL+VP+ P FGREPF HSIKEL G+AYDD Y LNTQSG+QWDGFRH+ Sbjct: 80 EIQSGEIVPLNLPLNVPEVPAFGREPFQHSIKELAPGLAYDDTYVLNTQSGTQWDGFRHI 139 Query: 208 SHSPTQTFY 234 +H P+ FY Sbjct: 140 AHMPSGKFY 148 >gb|EXJ60424.1| hypothetical protein A1O7_04576 [Cladophialophora yegresii CBS 114405] Length = 364 Score = 104 bits (259), Expect = 1e-20 Identities = 44/77 (57%), Positives = 55/77 (71%) Frame = +1 Query: 4 RTKRVLQEEVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGS 183 R K Q+E+RTG L+LPL+VP P FGR+ F H I L+ G+ YDD+Y +NTQSG+ Sbjct: 72 RVKAAAQQEIRTGEMARLDLPLNVPAQPAFGRQKFEHKILTLFDGVCYDDVYHMNTQSGT 131 Query: 184 QWDGFRHMSHSPTQTFY 234 QWDGFRH +H TQTFY Sbjct: 132 QWDGFRHFAHMATQTFY 148 >dbj|GAD95037.1| hypothetical protein CPC735_032850 [Byssochlamys spectabilis No. 5] Length = 377 Score = 104 bits (259), Expect = 1e-20 Identities = 47/77 (61%), Positives = 54/77 (70%) Frame = +1 Query: 4 RTKRVLQEEVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGS 183 R + E+RTG V LNLPL+ P+ P FGRE F H IK L I YDD Y+LNTQSG+ Sbjct: 70 RRVKAASAEIRTGEVVPLNLPLNTPETPAFGREKFVHKIKTLVDNICYDDQYELNTQSGT 129 Query: 184 QWDGFRHMSHSPTQTFY 234 QWDGFRH +H PTQTFY Sbjct: 130 QWDGFRHFAHVPTQTFY 146 >gb|ETI24743.1| hypothetical protein G647_04113 [Cladophialophora carrionii CBS 160.54] Length = 364 Score = 103 bits (256), Expect = 3e-20 Identities = 44/77 (57%), Positives = 55/77 (71%) Frame = +1 Query: 4 RTKRVLQEEVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGS 183 R K Q+E+RTG L+LPL+VP P FGR+ F H I ++ GI YDD+Y +NTQSG+ Sbjct: 72 RVKAAAQQEIRTGEMARLDLPLNVPAQPAFGRQKFEHKILTVFDGICYDDVYHMNTQSGT 131 Query: 184 QWDGFRHMSHSPTQTFY 234 QWDGFRH +H TQTFY Sbjct: 132 QWDGFRHFAHVATQTFY 148 >ref|XP_002544084.1| conserved hypothetical protein [Uncinocarpus reesii 1704] gi|237904354|gb|EEP78755.1| conserved hypothetical protein [Uncinocarpus reesii 1704] Length = 361 Score = 102 bits (255), Expect = 4e-20 Identities = 45/69 (65%), Positives = 55/69 (79%) Frame = +1 Query: 28 EVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRHM 207 E++TG V LNLPL+VP+ P FGRE F H+IK L+ IAYDD Y+LNTQSG+QWDGFRH Sbjct: 76 EIKTGEMVPLNLPLNVPETPAFGREKFVHTIKCLHENIAYDDKYELNTQSGTQWDGFRHF 135 Query: 208 SHSPTQTFY 234 +H T+TFY Sbjct: 136 AHMATETFY 144 >ref|XP_752609.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|66850244|gb|EAL90571.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|159131363|gb|EDP56476.1| conserved hypothetical protein [Aspergillus fumigatus A1163] Length = 369 Score = 102 bits (254), Expect = 6e-20 Identities = 45/69 (65%), Positives = 53/69 (76%) Frame = +1 Query: 28 EVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRHM 207 E++TG V L+LPL+VP+ P FGRE F H IK L G+AYDD Y LNTQSG+QWDGFRH Sbjct: 90 EIQTGEMVRLDLPLNVPETPAFGREAFQHKIKLLVEGVAYDDTYTLNTQSGTQWDGFRHF 149 Query: 208 SHSPTQTFY 234 SH +QTFY Sbjct: 150 SHIDSQTFY 158 >ref|XP_001264522.1| hypothetical protein NFIA_013140 [Neosartorya fischeri NRRL 181] gi|119412684|gb|EAW22625.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 370 Score = 102 bits (254), Expect = 6e-20 Identities = 45/69 (65%), Positives = 53/69 (76%) Frame = +1 Query: 28 EVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRHM 207 E++TG V L+LPL+VP+ P FGRE F H IK L G+AYDD Y LNTQSG+QWDGFRH Sbjct: 90 EIQTGEMVRLDLPLNVPETPAFGREAFQHKIKLLVEGVAYDDTYTLNTQSGTQWDGFRHF 149 Query: 208 SHSPTQTFY 234 SH +QTFY Sbjct: 150 SHIDSQTFY 158 >gb|ERF77093.1| hypothetical protein EPUS_06311 [Endocarpon pusillum Z07020] Length = 388 Score = 102 bits (253), Expect = 7e-20 Identities = 44/69 (63%), Positives = 54/69 (78%) Frame = +1 Query: 28 EVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRHM 207 E++TG + L+LPL+VP+ PGF RE F H IK L GIAYDD+Y+LNTQSG+QWDGFRH Sbjct: 76 EIKTGEVIPLDLPLNVPEVPGFSREQFKHKIKVLAEGIAYDDIYELNTQSGTQWDGFRHF 135 Query: 208 SHSPTQTFY 234 +H T TFY Sbjct: 136 AHVSTNTFY 144 >gb|EMD87219.1| hypothetical protein COCHEDRAFT_1206513 [Bipolaris maydis C5] gi|477583286|gb|ENI00386.1| hypothetical protein COCC4DRAFT_150796 [Bipolaris maydis ATCC 48331] Length = 365 Score = 101 bits (251), Expect = 1e-19 Identities = 42/70 (60%), Positives = 56/70 (80%) Frame = +1 Query: 25 EEVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRH 204 +E+++G V +NLPL+VP+ P FGR+PF H IK L G+AYDD+Y+LNTQSG+QWDGFRH Sbjct: 78 KEIKSGEIVPVNLPLNVPNAPAFGRQPFKHEIKTLVEGLAYDDVYNLNTQSGTQWDGFRH 137 Query: 205 MSHSPTQTFY 234 +H + TFY Sbjct: 138 FAHMASGTFY 147 >gb|ETN44636.1| hypothetical protein HMPREF1541_10306 [Cyphellophora europaea CBS 101466] Length = 374 Score = 100 bits (250), Expect = 2e-19 Identities = 44/77 (57%), Positives = 53/77 (68%) Frame = +1 Query: 4 RTKRVLQEEVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGS 183 R + + TG L+LPLHVP P FGR F H IK ++ G+AYDD Y LNTQSG+ Sbjct: 75 RIAAAAKASIVTGESARLDLPLHVPAQPAFGRRVFEHRIKAIHEGVAYDDEYTLNTQSGT 134 Query: 184 QWDGFRHMSHSPTQTFY 234 QWDGFRH++H PTQTFY Sbjct: 135 QWDGFRHVAHMPTQTFY 151 >ref|XP_007293004.1| hypothetical protein MBM_05115 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406863599|gb|EKD16646.1| hypothetical protein MBM_05115 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 366 Score = 100 bits (250), Expect = 2e-19 Identities = 44/70 (62%), Positives = 54/70 (77%) Frame = +1 Query: 25 EEVRTGRRVMLNLPLHVPDPPGFGREPFNHSIKELYSGIAYDDLYDLNTQSGSQWDGFRH 204 +E+RTG V LNLPL+VP+ P F RE F H IK + G+AYDD Y LNTQSG+QWDGFRH Sbjct: 79 KEIRTGDIVPLNLPLNVPNVPAFAREEFKHEIKSIADGLAYDDKYQLNTQSGTQWDGFRH 138 Query: 205 MSHSPTQTFY 234 ++H P+ TFY Sbjct: 139 IAHIPSATFY 148