BLASTX nr result
ID: Akebia25_contig00054102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00054102 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77265.1| hypothetical protein VITISV_041157 [Vitis vinifera] 56 6e-06 >emb|CAN77265.1| hypothetical protein VITISV_041157 [Vitis vinifera] Length = 242 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/54 (48%), Positives = 37/54 (68%) Frame = -3 Query: 169 KKEFQKLVALEEISWKEKSIVK*LKQADDNI*FFHKMTNYRIKFTFTSKLSFNG 8 K+EF+K V +EEISW++KS L++ D NI FFH+MTNY + +K+ NG Sbjct: 114 KEEFKKWVLMEEISWRQKSREVWLREGDRNIGFFHRMTNYHRRRNCLTKIKING 167