BLASTX nr result
ID: Akebia25_contig00054092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00054092 (490 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN73896.1| hypothetical protein [Otoglossum globuliferum] 74 2e-11 ref|XP_006364256.1| PREDICTED: putative membrane protein ycf1-li... 74 3e-11 ref|XP_006359584.1| PREDICTED: putative membrane protein ycf1-li... 74 3e-11 ref|XP_006340548.1| PREDICTED: putative membrane protein ycf1-li... 74 3e-11 ref|YP_008563147.1| hypothetical chloroplast RF1 (chloroplast) [... 74 3e-11 ref|YP_538908.1| hypothetical chloroplast RF1 [Solanum bulbocast... 74 3e-11 ref|YP_635697.1| hypothetical chloroplast RF1 [Solanum tuberosum... 74 3e-11 ref|AP_004975.1| hypothetical protein (chloroplast) [Solanum lyc... 74 3e-11 ref|AP_004987.1| ycf1 protein (chloroplast) [Solanum lycopersicu... 74 3e-11 ref|YP_398919.1| hypothetical protein NitoCp089 [Nicotiana tomen... 74 3e-11 ref|YP_398931.1| hypothetical protein NitoCp101 [Nicotiana tomen... 74 3e-11 ref|YP_358745.1| hypothetical protein NisyCp102 [Nicotiana sylve... 74 3e-11 ref|NP_054553.1| hypothetical protein NitaCp079 [Nicotiana tabac... 74 3e-11 prf||1211235CL ORF 350 74 3e-11 prf||1211235DC ORF 1244 74 3e-11 ref|YP_006666088.1| hypothetical protein RF1 (chloroplast) [Caps... 74 3e-11 ref|YP_004891674.1| ycf1 gene product (chloroplast) [Nicotiana u... 74 3e-11 ref|YP_004891662.1| unnamed protein product (chloroplast) [Nicot... 74 3e-11 gb|AEB72197.1| hypothetical chloroplast RF1 (chloroplast) [Solan... 74 3e-11 ref|YP_002720024.1| Ycf1 [Nicotiana tabacum] 74 3e-11 >gb|ACN73896.1| hypothetical protein [Otoglossum globuliferum] Length = 346 Score = 73.9 bits (180), Expect = 2e-11 Identities = 41/57 (71%), Positives = 44/57 (77%), Gaps = 3/57 (5%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYLLFID---LFLS 328 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+Y+ D LFL+ Sbjct: 97 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSTLAR---LVNIYMFRCDNKILFLT 150 >ref|XP_006364256.1| PREDICTED: putative membrane protein ycf1-like [Solanum tuberosum] Length = 452 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 222 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 264 >ref|XP_006359584.1| PREDICTED: putative membrane protein ycf1-like [Solanum tuberosum] Length = 443 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|XP_006340548.1| PREDICTED: putative membrane protein ycf1-like [Solanum tuberosum] Length = 684 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|YP_008563147.1| hypothetical chloroplast RF1 (chloroplast) [Solanum lycopersicum] gi|118577981|sp|Q2MI42.1|YCF1_SOLLC RecName: Full=Putative membrane protein ycf1; Short=RF1 gi|84372042|gb|ABC56359.1| hypothetical chloroplast RF1 (chloroplast) [Solanum lycopersicum] Length = 1891 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|YP_538908.1| hypothetical chloroplast RF1 [Solanum bulbocastanum] gi|118577980|sp|Q2MIC9.1|YCF1_SOLBU RecName: Full=Putative membrane protein ycf1; Short=RF1 gi|84371954|gb|ABC56272.1| hypothetical chloroplast RF1 [Solanum bulbocastanum] Length = 1887 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|YP_635697.1| hypothetical chloroplast RF1 [Solanum tuberosum] gi|118577982|sp|Q2VEC3.1|YCF1_SOLTU RecName: Full=Putative membrane protein ycf1; Short=RF1 gi|82754681|gb|ABB90095.1| ycf1 protein [Solanum tuberosum] gi|88656862|gb|ABD47115.1| hypothetical chloroplast RF1 [Solanum tuberosum] Length = 1887 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|AP_004975.1| hypothetical protein (chloroplast) [Solanum lycopersicum] gi|89241718|emb|CAJ32441.1| hypothetical protein [Solanum lycopersicum] Length = 379 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|AP_004987.1| ycf1 protein (chloroplast) [Solanum lycopersicum] gi|89241730|emb|CAJ32453.1| ycf1 protein [Solanum lycopersicum] Length = 1891 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|YP_398919.1| hypothetical protein NitoCp089 [Nicotiana tomentosiformis] gi|80750983|dbj|BAE48059.1| hypothetical protein [Nicotiana tomentosiformis] Length = 338 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 116 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 158 >ref|YP_398931.1| hypothetical protein NitoCp101 [Nicotiana tomentosiformis] gi|118574759|sp|Q33BW4.1|YCF1_NICTO RecName: Full=Putative membrane protein ycf1 gi|80750995|dbj|BAE48071.1| hypothetical protein [Nicotiana tomentosiformis] Length = 1892 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|YP_358745.1| hypothetical protein NisyCp102 [Nicotiana sylvestris] gi|231660|sp|P12222.2|YCF1_TOBAC RecName: Full=Putative membrane protein ycf1; AltName: Full=ORF 1901 gi|118574758|sp|Q3C1P6.1|YCF1_NICSY RecName: Full=Putative membrane protein ycf1 gi|76559647|emb|CAJ32485.1| hypothetical protein [Nicotiana tabacum] gi|77799633|dbj|BAE46722.1| hypothetical protein [Nicotiana sylvestris] Length = 1901 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|NP_054553.1| hypothetical protein NitaCp079 [Nicotiana tabacum] gi|78102594|ref|YP_358733.1| hypothetical protein NisyCp090 [Nicotiana sylvestris] gi|82214|pir||A05212 hypothetical protein 350 - common tobacco chloroplast gi|4388761|emb|CAA77394.1| hypothetical protein [Nicotiana tabacum] gi|77799621|dbj|BAE46710.1| hypothetical protein [Nicotiana sylvestris] Length = 350 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 116 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 158 >prf||1211235CL ORF 350 Length = 350 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 116 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 158 >prf||1211235DC ORF 1244 Length = 1000 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|YP_006666088.1| hypothetical protein RF1 (chloroplast) [Capsicum annuum] gi|401065990|gb|AFP90834.1| hypothetical protein RF1 (chloroplast) [Capsicum annuum] Length = 1906 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|YP_004891674.1| ycf1 gene product (chloroplast) [Nicotiana undulata] gi|347453974|gb|AEO95632.1| hypothetical chloroplast RF19 (chloroplast) [Nicotiana undulata] gi|347454084|gb|AEO95741.1| hypothetical chloroplast RF19 [synthetic construct] Length = 1901 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|YP_004891662.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453962|gb|AEO95620.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454072|gb|AEO95729.1| hypothetical protein [synthetic construct] Length = 339 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >gb|AEB72197.1| hypothetical chloroplast RF1 (chloroplast) [Solanum tuberosum] gi|329124727|gb|AEB72283.1| hypothetical chloroplast RF1 (chloroplast) [Solanum tuberosum] Length = 1887 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 115 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 157 >ref|YP_002720024.1| Ycf1 [Nicotiana tabacum] Length = 1902 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -2 Query: 489 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSKSARSSLTANLYL 352 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSS AR N+YL Sbjct: 116 STTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLAR---LVNIYL 158