BLASTX nr result
ID: Akebia25_contig00053894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00053894 (230 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC98303.1| hypothetical protein BAUCODRAFT_32321, partial [B... 83 5e-14 gb|EME44887.1| hypothetical protein DOTSEDRAFT_70811 [Dothistrom... 81 1e-13 gb|EME84358.1| hypothetical protein MYCFIDRAFT_152576 [Pseudocer... 79 7e-13 gb|EMF13115.1| hypothetical protein SEPMUDRAFT_148497 [Sphaeruli... 78 1e-12 ref|XP_003848747.1| hypothetical protein MYCGRDRAFT_62800 [Zymos... 78 1e-12 ref|XP_003295415.1| hypothetical protein PTT_00799 [Pyrenophora ... 75 1e-11 ref|XP_001931869.1| conserved hypothetical protein [Pyrenophora ... 75 1e-11 gb|EOA91801.1| hypothetical protein SETTUDRAFT_162380 [Setosphae... 74 2e-11 gb|ETN46053.1| hypothetical protein HMPREF1541_00236 [Cyphelloph... 74 2e-11 ref|XP_007292001.1| hypothetical protein MBM_04112 [Marssonina b... 72 1e-10 ref|XP_001804497.1| hypothetical protein SNOG_14303 [Phaeosphaer... 72 1e-10 gb|EMD93563.1| hypothetical protein COCHEDRAFT_1192871 [Bipolari... 71 1e-10 gb|EUC44513.1| hypothetical protein COCMIDRAFT_37697 [Bipolaris ... 71 2e-10 gb|EUC31744.1| hypothetical protein COCCADRAFT_38211 [Bipolaris ... 71 2e-10 dbj|GAD99064.1| conserved hypothetical protein [Byssochlamys spe... 71 2e-10 gb|EMD68233.1| hypothetical protein COCSADRAFT_33179 [Bipolaris ... 71 2e-10 gb|EGY22351.1| hypothetical protein VDAG_03789 [Verticillium dah... 70 2e-10 ref|XP_002151178.1| conserved hypothetical protein [Talaromyces ... 70 2e-10 ref|XP_002341862.1| conserved hypothetical protein [Talaromyces ... 70 3e-10 gb|ELR08719.1| hypothetical protein GMDG_03401 [Pseudogymnoascus... 70 4e-10 >gb|EMC98303.1| hypothetical protein BAUCODRAFT_32321, partial [Baudoinia compniacensis UAMH 10762] Length = 510 Score = 82.8 bits (203), Expect = 5e-14 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKK 144 WEGLVEEGN+LRREIK+VAEEYDVEW+E ++GDEKV +ALRE RKK+ Sbjct: 447 WEGLVEEGNRLRREIKMVAEEYDVEWDESKDEGDEKVREALREARKKE 494 >gb|EME44887.1| hypothetical protein DOTSEDRAFT_70811 [Dothistroma septosporum NZE10] Length = 490 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/52 (67%), Positives = 47/52 (90%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+EEGN+LRREIKL+A+EYDVEW+E +++GDEKV +ALR+ERKK ++K Sbjct: 427 WEMLIEEGNRLRREIKLIADEYDVEWDETEDEGDEKVREALRKERKKNDAKK 478 >gb|EME84358.1| hypothetical protein MYCFIDRAFT_152576 [Pseudocercospora fijiensis CIRAD86] Length = 473 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/50 (68%), Positives = 45/50 (90%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRS 150 WE L++EGN+LRREIK+VAEEYDV+W+E ++GDEKV +ALR+ERKKK + Sbjct: 409 WEMLIDEGNRLRREIKMVAEEYDVDWDETKDEGDEKVREALRKERKKKEA 458 >gb|EMF13115.1| hypothetical protein SEPMUDRAFT_148497 [Sphaerulina musiva SO2202] Length = 503 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/51 (64%), Positives = 46/51 (90%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQ 153 WE LVEEGN+LRREIK++AEEYDV+W+E ++GDEKV +AL++ER+KK+ + Sbjct: 438 WEMLVEEGNRLRREIKIIAEEYDVDWDETKDEGDEKVREALKKEREKKKEK 488 >ref|XP_003848747.1| hypothetical protein MYCGRDRAFT_62800 [Zymoseptoria tritici IPO323] gi|339468623|gb|EGP83723.1| hypothetical protein MYCGRDRAFT_62800 [Zymoseptoria tritici IPO323] Length = 459 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+EEGN+LRRE+KLVAEEYDVEW+E ++G+EKV KAL+ ERKK K Sbjct: 394 WEMLIEEGNRLRREVKLVAEEYDVEWDEMKDEGEEKVRKALQSERKKAAGGK 445 >ref|XP_003295415.1| hypothetical protein PTT_00799 [Pyrenophora teres f. teres 0-1] gi|311333328|gb|EFQ96492.1| hypothetical protein PTT_00799 [Pyrenophora teres f. teres 0-1] Length = 528 Score = 75.1 bits (183), Expect = 1e-11 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+E+GN LR+EIK +A EYDVEW+E DE+ DEKV AL++ERK+K +K Sbjct: 454 WEALIEDGNALRKEIKAIANEYDVEWDELDEEKDEKVQHALKKERKRKEDKK 505 >ref|XP_001931869.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973475|gb|EDU40974.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 527 Score = 75.1 bits (183), Expect = 1e-11 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+E+GN LR+EIK +A EYDVEW+E DE+ DEKV AL++ERK+K +K Sbjct: 453 WEALIEDGNALRKEIKAIANEYDVEWDELDEEKDEKVQHALKKERKRKEDKK 504 >gb|EOA91801.1| hypothetical protein SETTUDRAFT_162380 [Setosphaeria turcica Et28A] Length = 521 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+++GN LR+EIK VA EYDVEW+E E+ DEKV KALR+ER++K +K Sbjct: 451 WEALIDDGNALRKEIKAVANEYDVEWDELQEEKDEKVQKALRKERRRKEEKK 502 >gb|ETN46053.1| hypothetical protein HMPREF1541_00236 [Cyphellophora europaea CBS 101466] Length = 346 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNE-KDEQGDEKVSKALREERKKKRSQK 156 WEG +EE N +RREIK VA EYDV+WNE +DE GDEKV+KALR+ERK K Sbjct: 281 WEGYLEEANAMRREIKAVASEYDVDWNETQDEGGDEKVTKALRDERKNNNGTK 333 >ref|XP_007292001.1| hypothetical protein MBM_04112 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406864699|gb|EKD17743.1| hypothetical protein MBM_04112 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 548 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/50 (58%), Positives = 42/50 (84%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRS 150 WE ++EE N LR+EIK +A+EYDVEW+EK ++G E+V ALREER+K+++ Sbjct: 471 WESMIEEANALRKEIKAIADEYDVEWDEKKDEGSEEVHDALREERRKQKN 520 >ref|XP_001804497.1| hypothetical protein SNOG_14303 [Phaeosphaeria nodorum SN15] gi|160704715|gb|EAT78174.2| hypothetical protein SNOG_14303 [Phaeosphaeria nodorum SN15] Length = 480 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+++GN LR+EIK +A EYDVEW+E ++ DEKV +AL++ERKKK+ K Sbjct: 411 WEALIDDGNTLRKEIKAIANEYDVEWDELKDEKDEKVREALKDERKKKKQGK 462 >gb|EMD93563.1| hypothetical protein COCHEDRAFT_1192871 [Bipolaris maydis C5] gi|477589913|gb|ENI06988.1| hypothetical protein COCC4DRAFT_70481 [Bipolaris maydis ATCC 48331] Length = 521 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/52 (55%), Positives = 42/52 (80%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+E+GN LR+EIK +A EYDVEW+E ++ DEKV +AL++ER++K +K Sbjct: 449 WEALIEDGNTLRKEIKAIANEYDVEWDELQDEKDEKVQQALKKERRRKEEKK 500 >gb|EUC44513.1| hypothetical protein COCMIDRAFT_37697 [Bipolaris oryzae ATCC 44560] Length = 520 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/52 (55%), Positives = 42/52 (80%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+E+GN LRREIK +A EYDVEW+E ++ DEKV +AL++ER+++ +K Sbjct: 449 WEALIEDGNTLRREIKAIANEYDVEWDELQDEKDEKVQQALKKERRRQEEKK 500 >gb|EUC31744.1| hypothetical protein COCCADRAFT_38211 [Bipolaris zeicola 26-R-13] gi|578485508|gb|EUN23003.1| hypothetical protein COCVIDRAFT_41299 [Bipolaris victoriae FI3] Length = 520 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+E+GN LR+EIK +A EYDVEW+E ++ DEKV +AL+ ER++K +K Sbjct: 449 WEALIEDGNTLRKEIKAIANEYDVEWDELQDEKDEKVQQALKNERRRKEEKK 500 >dbj|GAD99064.1| conserved hypothetical protein [Byssochlamys spectabilis No. 5] Length = 487 Score = 70.9 bits (172), Expect = 2e-10 Identities = 27/51 (52%), Positives = 43/51 (84%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQ 153 W+ L++E N LR+EIK +A EYDV+W+E+ ++GDE+V+KAL++ERK+K + Sbjct: 424 WDSLIDEANSLRKEIKTIAAEYDVDWDERKDEGDERVTKALKQERKQKNGK 474 >gb|EMD68233.1| hypothetical protein COCSADRAFT_33179 [Bipolaris sorokiniana ND90Pr] Length = 520 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+E+GN LR+EIK +A EYDVEW+E ++ DEKV +AL+ ER++K +K Sbjct: 449 WEALIEDGNTLRKEIKAIANEYDVEWDELQDEKDEKVQQALKNERRRKEEKK 500 >gb|EGY22351.1| hypothetical protein VDAG_03789 [Verticillium dahliae VdLs.17] Length = 523 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WEGLVEE N LRREIK+VA EYDV+W+E + G E+V + L EE++KK+ +K Sbjct: 430 WEGLVEEANALRREIKMVANEYDVDWDEMVDLGGEEVKEVLEEEKEKKKKKK 481 >ref|XP_002151178.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] gi|210066085|gb|EEA20178.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] Length = 427 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/52 (55%), Positives = 43/52 (82%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+EE N LRREIK VAEEYDV+W+E+ ++ DE+V++AL+ ER++K ++ Sbjct: 351 WESLIEEANALRREIKTVAEEYDVDWDERGDEEDERVTEALKHERRQKEKRE 402 >ref|XP_002341862.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218725058|gb|EED24475.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 443 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/52 (55%), Positives = 43/52 (82%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKKRSQK 156 WE L+EE N LRREIK VAEEYDV+W+E+ ++ DE+V++AL+ ER++K ++ Sbjct: 376 WESLIEEANALRREIKTVAEEYDVDWDERGDEEDERVTEALKHERRQKERRE 427 >gb|ELR08719.1| hypothetical protein GMDG_03401 [Pseudogymnoascus destructans 20631-21] Length = 761 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +1 Query: 1 WEGLVEEGNKLRREIKLVAEEYDVEWNEKDEQGDEKVSKALREERKKK 144 WE LVEE N LR+E+K VAEEYDVEWNE ++ E V +ALR+ER+KK Sbjct: 691 WESLVEEANSLRKEVKKVAEEYDVEWNEMQDEASEIVHEALRKERRKK 738