BLASTX nr result
ID: Akebia25_contig00053881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00053881 (574 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588266.1| hypothetical protein MTR_1g005070 [Medicago ... 84 2e-14 ref|XP_002534686.1| conserved hypothetical protein [Ricinus comm... 63 6e-08 >ref|XP_003588266.1| hypothetical protein MTR_1g005070 [Medicago truncatula] gi|355477314|gb|AES58517.1| hypothetical protein MTR_1g005070 [Medicago truncatula] Length = 110 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 396 EFAAFPRPEKGLYCSPLFDMFIQYQYKLQLHQSGRATIEARSSL 527 +FAAFPRPEKGLYCSPLFDMFIQYQYKL+LHQSG+A EARS+L Sbjct: 67 QFAAFPRPEKGLYCSPLFDMFIQYQYKLKLHQSGKAPTEARSNL 110 >ref|XP_002534686.1| conserved hypothetical protein [Ricinus communis] gi|223524770|gb|EEF27700.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 62.8 bits (151), Expect = 6e-08 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -3 Query: 182 MIESRLLVAKPFAFLFLNQSRSRLLYCSRSGEATASTTAPPPR 54 MIESRLL+AK FAF FLNQSRSRLLY SRSGEA+A T AP PR Sbjct: 1 MIESRLLLAKAFAF-FLNQSRSRLLYFSRSGEASAYTRAPLPR 42