BLASTX nr result
ID: Akebia25_contig00053811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00053811 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007585638.1| putative stress protein ddr48 protein [Neofu... 63 5e-08 ref|XP_003853788.1| hypothetical protein MYCGRDRAFT_103686 [Zymo... 59 5e-07 gb|EOO04095.1| putative stress response protein [Togninia minima... 58 1e-06 gb|EME45763.1| hypothetical protein DOTSEDRAFT_71449 [Dothistrom... 58 2e-06 gb|ENH78341.1| stress protein ddr48 [Colletotrichum orbiculare M... 57 3e-06 >ref|XP_007585638.1| putative stress protein ddr48 protein [Neofusicoccum parvum UCRNP2] gi|485921084|gb|EOD46894.1| putative stress protein ddr48 protein [Neofusicoccum parvum UCRNP2] Length = 287 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/65 (49%), Positives = 40/65 (61%) Frame = -2 Query: 226 SKSGKGDSTIGKLMEKAGSALKNENIEQKGRSKREQEGFGDSNY*FTNGLMGIPSSRYRD 47 S GK DSTIGKLMEKAGS LK+E +E+KG KREQ G G N + + G S Y Sbjct: 77 SSEGKNDSTIGKLMEKAGSVLKSEKVEEKGHQKREQAGLGRDNDSYGSSGRGGNDSSYGS 136 Query: 46 CSKES 32 +++ Sbjct: 137 SGRDN 141 >ref|XP_003853788.1| hypothetical protein MYCGRDRAFT_103686 [Zymoseptoria tritici IPO323] gi|339473671|gb|EGP88764.1| hypothetical protein MYCGRDRAFT_103686 [Zymoseptoria tritici IPO323] Length = 315 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/49 (67%), Positives = 35/49 (71%) Frame = -2 Query: 241 DDNNISKSGKGDSTIGKLMEKAGSALKNENIEQKGRSKREQEGFGDSNY 95 DDNN SGK DST GKL+EKAGS L N IEQ GR KREQ G D+NY Sbjct: 270 DDNN--SSGK-DSTAGKLLEKAGSLLGNNKIEQSGREKREQAGQDDNNY 315 >gb|EOO04095.1| putative stress response protein [Togninia minima UCRPA7] Length = 221 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = -2 Query: 241 DDNNISKSGKGDSTIGKLMEKAGSALKNENIEQKGRSKREQEGFGDSNY 95 DD+ SK G GDSTIGK++EKAG N+ + KGRSKRE G+GD++Y Sbjct: 174 DDSYGSKKG-GDSTIGKVLEKAGDVFNNDKLGDKGRSKREGAGYGDNDY 221 >gb|EME45763.1| hypothetical protein DOTSEDRAFT_71449 [Dothistroma septosporum NZE10] Length = 266 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 3/55 (5%) Frame = -2 Query: 250 YGADDNNISKSGKGDSTIGKLMEKAGSALKNENIEQKGRSKREQEGFGD---SNY 95 YG+ + N S K DST+GKLMEKAGS + N+NI +KGR+KR +GD SNY Sbjct: 213 YGSSNRN-DGSNKNDSTMGKLMEKAGSMMGNDNIAEKGRNKRNDASYGDNDNSNY 266 >gb|ENH78341.1| stress protein ddr48 [Colletotrichum orbiculare MAFF 240422] Length = 275 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = -2 Query: 241 DDNNISKSGKGDSTIGKLMEKAGSALKNENIEQKGRSKREQEGFGDSNY 95 +D++ S KGDS GK++EKAGS +E +E KG +KRE +G+GD++Y Sbjct: 227 NDDDSRGSSKGDSKFGKVLEKAGSVFNSEKLENKGHAKREAKGYGDNDY 275