BLASTX nr result
ID: Akebia25_contig00053760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00053760 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282495.2| PREDICTED: bifunctional monodehydroascorbate... 63 5e-08 ref|XP_002529418.1| carbonic anhydrase, putative [Ricinus commun... 59 9e-07 ref|XP_006473002.1| PREDICTED: bifunctional monodehydroascorbate... 57 3e-06 ref|XP_006845947.1| hypothetical protein AMTR_s00157p00092470 [A... 57 3e-06 ref|XP_003538184.1| PREDICTED: bifunctional monodehydroascorbate... 57 3e-06 gb|EYU41598.1| hypothetical protein MIMGU_mgv1a011586mg [Mimulus... 55 8e-06 ref|XP_006303231.1| hypothetical protein CARUB_v10012300mg [Caps... 55 8e-06 ref|XP_002529419.1| carbonic anhydrase, putative [Ricinus commun... 55 8e-06 >ref|XP_002282495.2| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Vitis vinifera] gi|297746283|emb|CBI16339.3| unnamed protein product [Vitis vinifera] Length = 274 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/47 (63%), Positives = 40/47 (85%), Gaps = 2/47 (4%) Frame = +3 Query: 3 TIVEKVGTVSREQLNLLRAAVNNES--NARPLQPINNRSIYLYQPRI 137 TIV KV TV+REQ+NLLR AV+++S NARP+QPIN RS++ Y+PR+ Sbjct: 224 TIVNKVRTVTREQVNLLRVAVHDDSGSNARPIQPINRRSVHFYRPRV 270 >ref|XP_002529418.1| carbonic anhydrase, putative [Ricinus communis] gi|223531095|gb|EEF32944.1| carbonic anhydrase, putative [Ricinus communis] Length = 274 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/45 (66%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +3 Query: 3 TIVEKVGTVSREQLNLLRAAVNNES--NARPLQPINNRSIYLYQP 131 TIV+KV TV+REQ++LLR AV++ES NARPLQ IN RS++LY+P Sbjct: 224 TIVKKVRTVTREQVSLLRVAVHDESDTNARPLQQINGRSVHLYRP 268 >ref|XP_006473002.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Citrus sinensis] Length = 275 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/45 (66%), Positives = 37/45 (82%), Gaps = 2/45 (4%) Frame = +3 Query: 3 TIVEKVGTVSREQLNLLRAAVNNES--NARPLQPINNRSIYLYQP 131 TIV KV +V+REQ+ LLR AV++ES NARPLQPIN RS+ LY+P Sbjct: 224 TIVRKVRSVTREQVRLLRVAVHDESNTNARPLQPINMRSVKLYKP 268 >ref|XP_006845947.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda] gi|548848602|gb|ERN07622.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda] Length = 253 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = +3 Query: 6 IVEKVGTVSREQLNLLRAAVNN--ESNARPLQPINNRSIYLYQPR 134 IV+KV TVSREQL LLRAAV++ E+NARP QPIN R + LY PR Sbjct: 199 IVKKVRTVSREQLRLLRAAVHDEAEANARPTQPINKRVVDLYTPR 243 >ref|XP_003538184.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3 [Glycine max] Length = 279 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +3 Query: 3 TIVEKVGTVSREQLNLLRAAVNNESNARPLQPINNRSIYLYQP 131 T++ +V VSREQ+ LLR AV+++SNARPLQPINNR + LY P Sbjct: 227 TVLTEVRYVSREQIRLLRVAVHDDSNARPLQPINNRLVKLYIP 269 >gb|EYU41598.1| hypothetical protein MIMGU_mgv1a011586mg [Mimulus guttatus] Length = 277 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +3 Query: 3 TIVEKVGTVSREQLNLLRAAVNN--ESNARPLQPINNRSIYLYQP 131 T+ +KV TVSREQ+NLLR AV++ E NARPLQP N R IYLY P Sbjct: 229 TLNKKVKTVSREQVNLLREAVHDYAEVNARPLQPHNKRGIYLYGP 273 >ref|XP_006303231.1| hypothetical protein CARUB_v10012300mg [Capsella rubella] gi|482571942|gb|EOA36129.1| hypothetical protein CARUB_v10012300mg [Capsella rubella] Length = 276 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/47 (51%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +3 Query: 3 TIVEKVGTVSREQLNLLRAAVNNESN--ARPLQPINNRSIYLYQPRI 137 T+V K+ TV+R+Q+ LLR AV+++SN ARP+QP N R++++Y+PR+ Sbjct: 230 TVVRKIRTVTRKQVKLLRVAVHDDSNSNARPVQPTNKRTVHMYRPRV 276 >ref|XP_002529419.1| carbonic anhydrase, putative [Ricinus communis] gi|223531096|gb|EEF32945.1| carbonic anhydrase, putative [Ricinus communis] Length = 272 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = +3 Query: 3 TIVEKVGTVSREQLNLLRAAVNNE--SNARPLQPINNRSIYLYQP 131 TIV KV TV+REQ+ LLR AV++E SNARP+Q IN RS+ LY+P Sbjct: 224 TIVRKVRTVTREQVRLLRVAVHDESNSNARPIQGINGRSVQLYRP 268