BLASTX nr result
ID: Akebia25_contig00053505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00053505 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001727288.1| hypothetical protein AOR_1_408194 [Aspergill... 86 4e-15 ref|XP_746422.1| conserved hypothetical protein [Aspergillus fum... 86 5e-15 gb|EJP64779.1| fatty acid hydroxylase superfamily protein [Beauv... 86 5e-15 dbj|GAA87378.1| fatty acid hydroxylase superfamily protein [Aspe... 86 5e-15 ref|XP_002340193.1| conserved hypothetical protein [Talaromyces ... 86 5e-15 gb|EDP47091.1| conserved hypothetical protein [Aspergillus fumig... 86 5e-15 ref|XP_001267608.1| hypothetical protein NFIA_045300 [Neosartory... 86 5e-15 ref|XP_001274375.1| conserved hypothetical protein [Aspergillus ... 85 9e-15 ref|XP_006670943.1| Fatty acid hydroxylase [Cordyceps militaris ... 84 2e-14 gb|EFY94984.1| hypothetical protein MAA_09562 [Metarhizium aniso... 84 2e-14 gb|EHA26876.1| hypothetical protein ASPNIDRAFT_35696 [Aspergillu... 84 2e-14 ref|XP_001389497.1| hypothetical protein ANI_1_1454014 [Aspergil... 84 2e-14 ref|XP_001270533.1| conserved hypothetical protein [Aspergillus ... 84 2e-14 dbj|GAD93411.1| hypothetical protein PVAR5_2021 [Byssochlamys sp... 83 3e-14 gb|EPS28545.1| hypothetical protein PDE_03491 [Penicillium oxali... 83 3e-14 dbj|GAD93905.1| hypothetical protein ANI_1_130164 [Byssochlamys ... 83 4e-14 ref|XP_002563826.1| Pc20g13460 [Penicillium chrysogenum Wisconsi... 83 4e-14 ref|XP_001211639.1| conserved hypothetical protein [Aspergillus ... 82 8e-14 dbj|GAA83170.1| fatty acid hydroxylase superfamily protein [Aspe... 82 1e-13 gb|EHA18824.1| hypothetical protein ASPNIDRAFT_42641 [Aspergillu... 82 1e-13 >ref|XP_001727288.1| hypothetical protein AOR_1_408194 [Aspergillus oryzae RIB40] gi|238488593|ref|XP_002375534.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] gi|83770316|dbj|BAE60449.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220697922|gb|EED54262.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] gi|391866769|gb|EIT76037.1| hypothetical protein Ao3042_07914 [Aspergillus oryzae 3.042] Length = 348 Score = 86.3 bits (212), Expect = 4e-15 Identities = 36/47 (76%), Positives = 38/47 (80%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTCHDRIE KDNIDY + PL+ Sbjct: 302 HRKGWRKSHNYGKQTRLWDRIFGTCHDRIEGTKDNIDYVNSVNMPLF 348 >ref|XP_746422.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|66844044|gb|EAL84384.1| conserved hypothetical protein [Aspergillus fumigatus Af293] Length = 348 Score = 85.9 bits (211), Expect = 5e-15 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTCH+RIESA +N+DY + A PL+ Sbjct: 302 HRKGWRKSHNYGKQTRLWDRIFGTCHERIESAPENVDYVNTARMPLF 348 >gb|EJP64779.1| fatty acid hydroxylase superfamily protein [Beauveria bassiana ARSEF 2860] Length = 353 Score = 85.9 bits (211), Expect = 5e-15 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTCH+RIE +DN+DY++ A+ PL+ Sbjct: 307 HRKGWRKSHNYGKQTRLWDRIFGTCHERIELRQDNVDYDNQAHIPLW 353 >dbj|GAA87378.1| fatty acid hydroxylase superfamily protein [Aspergillus kawachii IFO 4308] Length = 347 Score = 85.9 bits (211), Expect = 5e-15 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWD+IFGTCH+RIESA+ N+DY Y PL+ Sbjct: 301 HRKGWRKSHNYGKQTRLWDQIFGTCHERIESAESNVDYTKSVYMPLF 347 >ref|XP_002340193.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218723389|gb|EED22806.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 317 Score = 85.9 bits (211), Expect = 5e-15 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTCH+RIES NIDY + AY P++ Sbjct: 271 HRKGWRKSHNYGKQTRLWDRIFGTCHERIESIDSNIDYVNTAYMPVF 317 >gb|EDP47091.1| conserved hypothetical protein [Aspergillus fumigatus A1163] Length = 348 Score = 85.9 bits (211), Expect = 5e-15 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTCH+RIESA +N+DY + A PL+ Sbjct: 302 HRKGWRKSHNYGKQTRLWDRIFGTCHERIESAPENVDYLNTARMPLF 348 >ref|XP_001267608.1| hypothetical protein NFIA_045300 [Neosartorya fischeri NRRL 181] gi|119415774|gb|EAW25711.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 348 Score = 85.9 bits (211), Expect = 5e-15 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTCH+RIESA +N+DY + A PL+ Sbjct: 302 HRKGWRKSHNYGKQTRLWDRIFGTCHERIESAAENVDYVNTARMPLF 348 >ref|XP_001274375.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] gi|119402528|gb|EAW12949.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] Length = 348 Score = 85.1 bits (209), Expect = 9e-15 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTCH+RIESA DN+DY+ PL+ Sbjct: 302 HRKGWKKSHNYGKQTRLWDRIFGTCHERIESATDNVDYDTKISMPLW 348 >ref|XP_006670943.1| Fatty acid hydroxylase [Cordyceps militaris CM01] gi|346321979|gb|EGX91578.1| Fatty acid hydroxylase [Cordyceps militaris CM01] Length = 407 Score = 84.3 bits (207), Expect = 2e-14 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTR+WDR+FGTCHDRIE K+N+DY + A PL+ Sbjct: 361 HRKGWRKSHNYGKQTRVWDRLFGTCHDRIELVKENVDYTNQARIPLF 407 >gb|EFY94984.1| hypothetical protein MAA_09562 [Metarhizium anisopliae ARSEF 23] gi|594713470|gb|EXU96404.1| fatty acid hydroxylase [Metarhizium robertsii] Length = 354 Score = 84.3 bits (207), Expect = 2e-14 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDR+FGTC DR+ESA DN+DY + A+ PL+ Sbjct: 308 HRKGWRKSHNYGKQTRLWDRVFGTCLDRVESAPDNVDYVNPAHVPLF 354 >gb|EHA26876.1| hypothetical protein ASPNIDRAFT_35696 [Aspergillus niger ATCC 1015] Length = 347 Score = 84.0 bits (206), Expect = 2e-14 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTCH+RIES + N+DY + PL+ Sbjct: 301 HRKGWRKSHNYGKQTRLWDRIFGTCHERIESVESNVDYTKSVHMPLF 347 >ref|XP_001389497.1| hypothetical protein ANI_1_1454014 [Aspergillus niger CBS 513.88] gi|134055614|emb|CAK37260.1| unnamed protein product [Aspergillus niger] Length = 347 Score = 84.0 bits (206), Expect = 2e-14 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTCH+RIES + N+DY + PL+ Sbjct: 301 HRKGWRKSHNYGKQTRLWDRIFGTCHERIESVESNVDYTKSVHMPLF 347 >ref|XP_001270533.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] gi|119398678|gb|EAW09107.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] Length = 347 Score = 84.0 bits (206), Expect = 2e-14 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDR+FGTCH RIES +N+DY + A PL+ Sbjct: 301 HRKGWRKSHNYGKQTRLWDRVFGTCHGRIESVAENVDYGNTARMPLF 347 >dbj|GAD93411.1| hypothetical protein PVAR5_2021 [Byssochlamys spectabilis No. 5] Length = 357 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPL 140 HR GW SHNYGKQTRLWDRIFGTCHDRIES K NIDY + PL Sbjct: 311 HRYGWRKSHNYGKQTRLWDRIFGTCHDRIESVKGNIDYENTVTLPL 356 >gb|EPS28545.1| hypothetical protein PDE_03491 [Penicillium oxalicum 114-2] Length = 348 Score = 83.2 bits (204), Expect = 3e-14 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWD+IFGTC +R+ES DN+DY +VA PL+ Sbjct: 302 HRKGWRKSHNYGKQTRLWDKIFGTCTERVESVADNVDYTNVARMPLF 348 >dbj|GAD93905.1| hypothetical protein ANI_1_130164 [Byssochlamys spectabilis No. 5] Length = 350 Score = 82.8 bits (203), Expect = 4e-14 Identities = 35/47 (74%), Positives = 37/47 (78%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTCH+RIES DNIDY PL+ Sbjct: 304 HRKGWKKSHNYGKQTRLWDRIFGTCHERIESTDDNIDYTADVRVPLW 350 >ref|XP_002563826.1| Pc20g13460 [Penicillium chrysogenum Wisconsin 54-1255] gi|211588561|emb|CAP86675.1| Pc20g13460 [Penicillium chrysogenum Wisconsin 54-1255] Length = 348 Score = 82.8 bits (203), Expect = 4e-14 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTC +RIES K NIDY + A PL+ Sbjct: 302 HRKGWRKSHNYGKQTRLWDRIFGTCTERIESEKGNIDYENTAEMPLF 348 >ref|XP_001211639.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114195723|gb|EAU37423.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 346 Score = 82.0 bits (201), Expect = 8e-14 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWDRIFGTC DRIE+ ++N+DY +V PL+ Sbjct: 300 HRKGWRKSHNYGKQTRLWDRIFGTCGDRIEAVEENVDYENVVPMPLW 346 >dbj|GAA83170.1| fatty acid hydroxylase superfamily protein [Aspergillus kawachii IFO 4308] Length = 349 Score = 81.6 bits (200), Expect = 1e-13 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWD+IFGTCH+RIES ++N+DY + P++ Sbjct: 303 HRKGWKKSHNYGKQTRLWDKIFGTCHERIESREENVDYENPVRMPIF 349 >gb|EHA18824.1| hypothetical protein ASPNIDRAFT_42641 [Aspergillus niger ATCC 1015] Length = 338 Score = 81.6 bits (200), Expect = 1e-13 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = +3 Query: 3 HRKGWNNSHNYGKQTRLWDRIFGTCHDRIESAKDNIDYNDVAYFPLY 143 HRKGW SHNYGKQTRLWD+IFGTCH+RIES + N+DY++ P++ Sbjct: 292 HRKGWKKSHNYGKQTRLWDKIFGTCHERIESREGNVDYDNTVRMPIF 338