BLASTX nr result
ID: Akebia25_contig00053232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00053232 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628... 72 1e-10 ref|XP_006432878.1| hypothetical protein CICLE_v100013712mg, par... 72 1e-10 gb|ACF05806.1| PAE [Litchi chinensis] 71 1e-10 ref|XP_006385140.1| hypothetical protein POPTR_0004s24220g [Popu... 67 2e-09 ref|XP_006385138.1| hypothetical protein POPTR_0004s24220g [Popu... 67 2e-09 ref|XP_006385136.1| hypothetical protein POPTR_0004s24220g [Popu... 67 2e-09 ref|XP_006385134.1| hypothetical protein POPTR_0004s24220g [Popu... 67 2e-09 ref|XP_007040902.1| Pectinacetylesterase family protein [Theobro... 66 4e-09 ref|XP_006385137.1| hypothetical protein POPTR_0004s24220g [Popu... 65 8e-09 ref|XP_002273920.2| PREDICTED: protein notum homolog [Vitis vini... 65 1e-08 emb|CBI29219.3| unnamed protein product [Vitis vinifera] 65 1e-08 gb|EYU37455.1| hypothetical protein MIMGU_mgv1a007934mg [Mimulus... 63 5e-08 ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [A... 62 6e-08 emb|CAA67728.1| pectinacetylesterase precursor [Vigna radiata va... 62 8e-08 ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus com... 62 8e-08 ref|XP_007040900.1| Pectinacetylesterase family protein [Theobro... 61 1e-07 ref|XP_006599203.1| PREDICTED: uncharacterized protein LOC100781... 60 2e-07 gb|EMT14315.1| hypothetical protein F775_08483 [Aegilops tauschii] 60 4e-07 ref|XP_006432880.1| hypothetical protein CICLE_v10001467mg [Citr... 59 5e-07 ref|XP_007156331.1| hypothetical protein PHAVU_003G277500g [Phas... 59 7e-07 >ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628021 [Citrus sinensis] Length = 399 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +3 Query: 204 MIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 M+ AR LN+ VC LI++K DGF VGITYV+NAV GAVCLDGSPPA H Sbjct: 1 MVAARMGQWLNLLVCALILLKADGFNVGITYVENAVVKGAVCLDGSPPAYH 51 >ref|XP_006432878.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina] gi|557535000|gb|ESR46118.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina] Length = 276 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +3 Query: 204 MIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 M+ AR LN+ VC LI++K DGF VGITYV+NAV GAVCLDGSPPA H Sbjct: 1 MVAARMGQWLNLLVCALILLKADGFNVGITYVENAVVKGAVCLDGSPPAYH 51 >gb|ACF05806.1| PAE [Litchi chinensis] Length = 399 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = +3 Query: 204 MIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 M+DAR L++ VC LI++K +GF VGITYV+NAVA GAVCLDGSPPA H Sbjct: 1 MVDARWSPWLSLLVCGLILLKTEGFDVGITYVENAVAKGAVCLDGSPPAYH 51 >ref|XP_006385140.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa] gi|550341908|gb|ERP62937.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa] Length = 325 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +3 Query: 201 RMIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 RM+D+R L + V L++++K G YVGITYV++AVA GAVCLDGSPPA H Sbjct: 3 RMVDSRLGHWLKLLVSLMLLLKTQGLYVGITYVKSAVAKGAVCLDGSPPAYH 54 >ref|XP_006385138.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa] gi|550341906|gb|ERP62935.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa] Length = 402 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +3 Query: 201 RMIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 RM+D+R L + V L++++K G YVGITYV++AVA GAVCLDGSPPA H Sbjct: 3 RMVDSRLGHWLKLLVSLMLLLKTQGLYVGITYVKSAVAKGAVCLDGSPPAYH 54 >ref|XP_006385136.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa] gi|550341904|gb|ERP62933.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa] Length = 391 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +3 Query: 201 RMIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 RM+D+R L + V L++++K G YVGITYV++AVA GAVCLDGSPPA H Sbjct: 3 RMVDSRLGHWLKLLVSLMLLLKTQGLYVGITYVKSAVAKGAVCLDGSPPAYH 54 >ref|XP_006385134.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa] gi|550341902|gb|ERP62931.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa] Length = 430 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +3 Query: 201 RMIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 RM+D+R L + V L++++K G YVGITYV++AVA GAVCLDGSPPA H Sbjct: 3 RMVDSRLGHWLKLLVSLMLLLKTQGLYVGITYVKSAVAKGAVCLDGSPPAYH 54 >ref|XP_007040902.1| Pectinacetylesterase family protein [Theobroma cacao] gi|508778147|gb|EOY25403.1| Pectinacetylesterase family protein [Theobroma cacao] Length = 401 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = +3 Query: 204 MIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 M+D RSC L++ V L+ K G YV ITYVQ+AVA GAVCLDGSPPA H Sbjct: 1 MVDTRSCQWLHLLVLGLLWFKTQGVYVPITYVQSAVAKGAVCLDGSPPAYH 51 >ref|XP_006385137.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa] gi|566168428|ref|XP_006385139.1| pectinacetylesterase family protein [Populus trichocarpa] gi|550341905|gb|ERP62934.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa] gi|550341907|gb|ERP62936.1| pectinacetylesterase family protein [Populus trichocarpa] Length = 399 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = +3 Query: 204 MIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 M+D+R L + V L++++K G YVGITYV++AVA GAVCLDGSPPA H Sbjct: 1 MVDSRLGHWLKLLVSLMLLLKTQGLYVGITYVKSAVAKGAVCLDGSPPAYH 51 >ref|XP_002273920.2| PREDICTED: protein notum homolog [Vitis vinifera] Length = 521 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +3 Query: 204 MIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 M AR+ L++ LI++K +GFYVGITYV +AVA GAVCLDGSPPA H Sbjct: 1 MAKARTGHWLSILAFSLILLKTEGFYVGITYVDSAVAKGAVCLDGSPPAYH 51 >emb|CBI29219.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +3 Query: 204 MIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 M AR+ L++ LI++K +GFYVGITYV +AVA GAVCLDGSPPA H Sbjct: 1 MAKARTGHWLSILAFSLILLKTEGFYVGITYVDSAVAKGAVCLDGSPPAYH 51 >gb|EYU37455.1| hypothetical protein MIMGU_mgv1a007934mg [Mimulus guttatus] Length = 390 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +3 Query: 231 LNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 L + +CL+I+++ +G YV ITYVQ AVA GAVCLDGSPPA H Sbjct: 4 LRITLCLVILLRTEGLYVNITYVQTAVAKGAVCLDGSPPAYH 45 >ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda] gi|548832007|gb|ERM94809.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda] Length = 398 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = +3 Query: 207 IDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 +D + G L + V L+I +K DGF+V ITYV AVA GAVCLDGSPPA H Sbjct: 1 MDRQRNGCLKLLVFLVISLKADGFFVDITYVTTAVAKGAVCLDGSPPAYH 50 >emb|CAA67728.1| pectinacetylesterase precursor [Vigna radiata var. radiata] Length = 399 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/42 (61%), Positives = 36/42 (85%) Frame = +3 Query: 231 LNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 L+V +C+++++K +G VGIT+V+NAVA GAVCLDGSPPA H Sbjct: 10 LSVLICVVLLLKAEGVPVGITFVENAVAKGAVCLDGSPPAYH 51 >ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus communis] gi|223540957|gb|EEF42515.1| pectin acetylesterase, putative [Ricinus communis] Length = 399 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +3 Query: 204 MIDARSCGLLNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 M+D+R L + C+L++ +G +V ITYV+NAVA GAVCLDGSPPA H Sbjct: 1 MVDSRLGQWLILLACVLLLTNTEGLFVEITYVKNAVAKGAVCLDGSPPAYH 51 >ref|XP_007040900.1| Pectinacetylesterase family protein [Theobroma cacao] gi|508778145|gb|EOY25401.1| Pectinacetylesterase family protein [Theobroma cacao] Length = 399 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/52 (61%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +3 Query: 204 MIDARSCGLLNVFVC-LLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 M+ AR L++ VC LLI++K +G VGITY+Q+AVA GAVCLDGSPPA H Sbjct: 1 MLGARLGQWLSLLVCCLLILLKAEGGSVGITYLQSAVAKGAVCLDGSPPAYH 52 >ref|XP_006599203.1| PREDICTED: uncharacterized protein LOC100781246 isoform X1 [Glycine max] gi|571527154|ref|XP_006599204.1| PREDICTED: uncharacterized protein LOC100781246 isoform X2 [Glycine max] gi|571527158|ref|XP_006599205.1| PREDICTED: uncharacterized protein LOC100781246 isoform X3 [Glycine max] Length = 399 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/42 (59%), Positives = 36/42 (85%) Frame = +3 Query: 231 LNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 L++ +C+L++++ +G VGIT+V+NAVA GAVCLDGSPPA H Sbjct: 10 LSLLICVLLLLQTEGVPVGITFVENAVAKGAVCLDGSPPAYH 51 >gb|EMT14315.1| hypothetical protein F775_08483 [Aegilops tauschii] Length = 400 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 234 NVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 + F C L +++ DG++V ITYV++AVA GAVCLDGSPPA H Sbjct: 12 SAFACALAVLEADGYFVDITYVESAVAKGAVCLDGSPPAYH 52 >ref|XP_006432880.1| hypothetical protein CICLE_v10001467mg [Citrus clementina] gi|568835136|ref|XP_006471635.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis] gi|568835138|ref|XP_006471636.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis] gi|557535002|gb|ESR46120.1| hypothetical protein CICLE_v10001467mg [Citrus clementina] Length = 386 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +3 Query: 234 NVFVCLLIMVKVD-GFYVGITYVQNAVAHGAVCLDGSPPASH 356 N+ VC LI++K GF V ITYV+NAVA GAVCLDGSPPA H Sbjct: 6 NLLVCALIVLKAQAGFNVSITYVENAVAKGAVCLDGSPPAYH 47 >ref|XP_007156331.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris] gi|561029685|gb|ESW28325.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris] Length = 417 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 231 LNVFVCLLIMVKVDGFYVGITYVQNAVAHGAVCLDGSPPASH 356 L+V +C+++++K +G VGIT+V+NAVA GAVCLDGS PA H Sbjct: 28 LSVLICVVLLLKAEGVPVGITFVENAVAKGAVCLDGSAPAYH 69