BLASTX nr result
ID: Akebia25_contig00053207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00053207 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003853691.1| hypothetical protein MYCGRDRAFT_69411 [Zymos... 97 3e-18 gb|EMF13379.1| DUF1295-domain-containing protein [Sphaerulina mu... 94 3e-17 gb|ESZ96401.1| hypothetical protein SBOR_3233 [Sclerotinia borea... 92 6e-17 gb|EME84135.1| hypothetical protein MYCFIDRAFT_152401 [Pseudocer... 92 6e-17 gb|EME44967.1| hypothetical protein DOTSEDRAFT_70871 [Dothistrom... 92 6e-17 gb|ETN37655.1| hypothetical protein HMPREF1541_07278 [Cyphelloph... 91 2e-16 gb|EKG13319.1| 3-oxo-5-alpha-steroid 4-dehydrogenase [Macrophomi... 90 3e-16 gb|EPE27086.1| hypothetical protein GLAREA_03000 [Glarea lozoyen... 90 4e-16 ref|XP_007290733.1| hypothetical protein MBM_02844 [Marssonina b... 90 4e-16 ref|XP_007582363.1| putative 3-oxo-5-alpha-steroid 4-dehydrogena... 89 6e-16 ref|XP_003305945.1| hypothetical protein PTT_18925 [Pyrenophora ... 89 6e-16 gb|EOA91742.1| hypothetical protein SETTUDRAFT_113714 [Setosphae... 89 8e-16 ref|XP_001796795.1| hypothetical protein SNOG_06423 [Phaeosphaer... 89 8e-16 gb|EMC97831.1| hypothetical protein BAUCODRAFT_405499 [Baudoinia... 88 1e-15 ref|XP_003843916.1| hypothetical protein LEMA_P015670.1 [Leptosp... 88 1e-15 ref|XP_001931732.1| conserved hypothetical protein [Pyrenophora ... 88 1e-15 emb|CCF43333.1| hypothetical protein CH063_03047 [Colletotrichum... 88 1e-15 ref|XP_007596617.1| hypothetical protein CFIO01_10911 [Colletotr... 87 2e-15 gb|EPE05016.1| 3-oxo-5-alpha-steroid 4-dehydrogenase [Ophiostoma... 87 2e-15 gb|ETS74486.1| hypothetical protein PFICI_14352 [Pestalotiopsis ... 86 4e-15 >ref|XP_003853691.1| hypothetical protein MYCGRDRAFT_69411 [Zymoseptoria tritici IPO323] gi|339473574|gb|EGP88667.1| hypothetical protein MYCGRDRAFT_69411 [Zymoseptoria tritici IPO323] Length = 328 Score = 96.7 bits (239), Expect = 3e-18 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = +1 Query: 1 AAVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 AAVSPAFVTFLLLKVSGVPMSE+KYDKRYGDRKDY++WK+ TPMFIPKL Sbjct: 280 AAVSPAFVTFLLLKVSGVPMSETKYDKRYGDRKDYRQWKKNTPMFIPKL 328 >gb|EMF13379.1| DUF1295-domain-containing protein [Sphaerulina musiva SO2202] Length = 328 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +1 Query: 1 AAVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 AA+SPAFVTFLL KVSG+PMSE KYDKRYGDRKDYQEWK+ TP+F PKL Sbjct: 280 AAISPAFVTFLLFKVSGIPMSEKKYDKRYGDRKDYQEWKKNTPVFFPKL 328 >gb|ESZ96401.1| hypothetical protein SBOR_3233 [Sclerotinia borealis F-4157] Length = 326 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 AAVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 A VSPAFVTFLLLKVSGVP+SE KYDK+YG RKDYQEWK+ TPMFIPKL Sbjct: 278 AGVSPAFVTFLLLKVSGVPLSEGKYDKKYGHRKDYQEWKKNTPMFIPKL 326 >gb|EME84135.1| hypothetical protein MYCFIDRAFT_152401 [Pseudocercospora fijiensis CIRAD86] Length = 328 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = +1 Query: 1 AAVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPK 144 AAVSPAFVTFLL KVSG+PMSE KYDKRYGDRKDYQEWK+ TP+F PK Sbjct: 280 AAVSPAFVTFLLFKVSGIPMSEKKYDKRYGDRKDYQEWKKNTPVFFPK 327 >gb|EME44967.1| hypothetical protein DOTSEDRAFT_70871 [Dothistroma septosporum NZE10] Length = 327 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +1 Query: 1 AAVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 AAVSPAFVTFLL KVSG+P+SE KYD+RYG+RKDYQEWK+ TPMFIPKL Sbjct: 279 AAVSPAFVTFLLFKVSGIPLSEKKYDERYGNRKDYQEWKKNTPMFIPKL 327 >gb|ETN37655.1| hypothetical protein HMPREF1541_07278 [Cyphellophora europaea CBS 101466] Length = 330 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +1 Query: 1 AAVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 A VSPAFVTFLLLKVSGVP+SESKYDKRYGDR DY++WK TTP FIPK+ Sbjct: 280 AGVSPAFVTFLLLKVSGVPLSESKYDKRYGDRADYKKWKETTPKFIPKI 328 >gb|EKG13319.1| 3-oxo-5-alpha-steroid 4-dehydrogenase [Macrophomina phaseolina MS6] Length = 320 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +1 Query: 4 AVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPK 144 AVSPAFV FLLLKVSG+P+SE+KYDKRYGDRKDYQEWKR TPM PK Sbjct: 271 AVSPAFVAFLLLKVSGIPLSENKYDKRYGDRKDYQEWKRNTPMLFPK 317 >gb|EPE27086.1| hypothetical protein GLAREA_03000 [Glarea lozoyensis ATCC 20868] Length = 327 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +1 Query: 4 AVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPK 144 AVSPAFVTFLL KVSG+P+SE+KYDKRYGDRKDYQ+WK+ TPMF PK Sbjct: 280 AVSPAFVTFLLFKVSGIPLSENKYDKRYGDRKDYQKWKKETPMFFPK 326 >ref|XP_007290733.1| hypothetical protein MBM_02844 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866567|gb|EKD19607.1| hypothetical protein MBM_02844 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 325 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 7 VSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 VSPAFVTFLLLKVSGVP+SE KYDK+YGDRK+Y+EWK TPMFIPKL Sbjct: 279 VSPAFVTFLLLKVSGVPLSEKKYDKKYGDRKEYREWKENTPMFIPKL 325 >ref|XP_007582363.1| putative 3-oxo-5-alpha-steroid 4-dehydrogenase protein [Neofusicoccum parvum UCRNP2] gi|485925631|gb|EOD50154.1| putative 3-oxo-5-alpha-steroid 4-dehydrogenase protein [Neofusicoccum parvum UCRNP2] Length = 319 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +1 Query: 4 AVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPK 144 AVSPAFV FLLLKVSG+P+SE+KYDKRYGDRKDYQEWK+ TPM PK Sbjct: 271 AVSPAFVAFLLLKVSGIPLSENKYDKRYGDRKDYQEWKKNTPMLFPK 317 >ref|XP_003305945.1| hypothetical protein PTT_18925 [Pyrenophora teres f. teres 0-1] gi|311316823|gb|EFQ85967.1| hypothetical protein PTT_18925 [Pyrenophora teres f. teres 0-1] Length = 330 Score = 89.0 bits (219), Expect = 6e-16 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +1 Query: 4 AVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 A SPAFV+FLLLKVSGVP+SE+KYDK+YGDR+DYQ+WKR TPMF+PK+ Sbjct: 282 AASPAFVSFLLLKVSGVPLSENKYDKKYGDREDYQKWKRETPMFVPKI 329 >gb|EOA91742.1| hypothetical protein SETTUDRAFT_113714 [Setosphaeria turcica Et28A] Length = 330 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = +1 Query: 4 AVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPK 144 A SPAFV+FLLLK+SGVP+SE+KYDKRYGDR+DYQ WKR TPMF+PK Sbjct: 282 AASPAFVSFLLLKISGVPLSENKYDKRYGDREDYQRWKRETPMFVPK 328 >ref|XP_001796795.1| hypothetical protein SNOG_06423 [Phaeosphaeria nodorum SN15] gi|111065134|gb|EAT86254.1| hypothetical protein SNOG_06423 [Phaeosphaeria nodorum SN15] Length = 330 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +1 Query: 4 AVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPK 144 A SPAFV+FLLLKVSGVP+SE+KYDK+YGDRKDYQ+WKR TPMF PK Sbjct: 282 AASPAFVSFLLLKVSGVPLSENKYDKKYGDRKDYQKWKRETPMFFPK 328 >gb|EMC97831.1| hypothetical protein BAUCODRAFT_405499 [Baudoinia compniacensis UAMH 10762] Length = 326 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/49 (83%), Positives = 42/49 (85%) Frame = +1 Query: 1 AAVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 A SPAFVT LLL VSGVP+SESKYDKRYGDRKDYQ WK TPMFIPKL Sbjct: 278 AGASPAFVTLLLLYVSGVPLSESKYDKRYGDRKDYQRWKEETPMFIPKL 326 >ref|XP_003843916.1| hypothetical protein LEMA_P015670.1 [Leptosphaeria maculans JN3] gi|312220496|emb|CBY00437.1| hypothetical protein LEMA_P015670.1 [Leptosphaeria maculans JN3] Length = 332 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +1 Query: 4 AVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPK 144 A SPAFVTFLLLKVSGVP+SE KYDKRYGDRKDY++WK TPMFIPK Sbjct: 285 AASPAFVTFLLLKVSGVPLSEEKYDKRYGDRKDYKKWKDETPMFIPK 331 >ref|XP_001931732.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973338|gb|EDU40837.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 329 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = +1 Query: 4 AVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPK 144 A SPAFV+FLLLK+SGVP+SE+KYDK+YGDR+DYQ+WKR TPMFIPK Sbjct: 282 AASPAFVSFLLLKISGVPLSENKYDKKYGDREDYQKWKRETPMFIPK 328 >emb|CCF43333.1| hypothetical protein CH063_03047 [Colletotrichum higginsianum] Length = 327 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +1 Query: 7 VSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 VSPAFV+FLLLKVSGVPMSE KYDKRYGDRKDYQEWK++TP PK+ Sbjct: 280 VSPAFVSFLLLKVSGVPMSEKKYDKRYGDRKDYQEWKKSTPKLFPKI 326 >ref|XP_007596617.1| hypothetical protein CFIO01_10911 [Colletotrichum fioriniae PJ7] gi|588898763|gb|EXF79739.1| hypothetical protein CFIO01_10911 [Colletotrichum fioriniae PJ7] Length = 326 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +1 Query: 7 VSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 VSPAFV+FLLLKVSGVPMSE KYDKRYGDRKDYQEWK+ TP PK+ Sbjct: 279 VSPAFVSFLLLKVSGVPMSEKKYDKRYGDRKDYQEWKKNTPKLFPKI 325 >gb|EPE05016.1| 3-oxo-5-alpha-steroid 4-dehydrogenase [Ophiostoma piceae UAMH 11346] Length = 303 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +1 Query: 1 AAVSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 AAVSPAF +F+LLK+SGVPMSE KYDKRYGDR DYQ WKR TP+F PKL Sbjct: 254 AAVSPAFTSFILLKLSGVPMSEPKYDKRYGDRADYQAWKRNTPLFFPKL 302 >gb|ETS74486.1| hypothetical protein PFICI_14352 [Pestalotiopsis fici W106-1] Length = 331 Score = 86.3 bits (212), Expect = 4e-15 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +1 Query: 7 VSPAFVTFLLLKVSGVPMSESKYDKRYGDRKDYQEWKRTTPMFIPKL 147 VSPAFVT LL KVSG+PMSE KYD+RYGDRKDYQEWK+ TP +IPKL Sbjct: 284 VSPAFVTLLLTKVSGIPMSEKKYDQRYGDRKDYQEWKKNTPKYIPKL 330