BLASTX nr result
ID: Akebia25_contig00053193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00053193 (455 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK38382.1|AC079028_6 hypothetical protein [Arabidopsis thali... 41 6e-07 gb|AAG50898.1|AC068901_7 hypothetical protein [Arabidopsis thali... 41 6e-07 gb|AAD03367.1| putative retroelement pol polyprotein [Arabidopsi... 39 9e-06 >gb|AAK38382.1|AC079028_6 hypothetical protein [Arabidopsis thaliana] Length = 257 Score = 40.8 bits (94), Expect(3) = 6e-07 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = -3 Query: 276 FCNSHKIQQKFSNPKYTKGNGILDATNKAILEDIKK 169 FC+ KI+ S P Y +GNG +A NKAIL +IKK Sbjct: 91 FCDKWKIRLTTSTPHYPQGNGQAEAANKAILSNIKK 126 Score = 28.9 bits (63), Expect(3) = 6e-07 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 101 P*KITLESPFSLTYWMKTAIPTRMLIP 21 P K T E+PFSL Y ++ IP +IP Sbjct: 150 PRKSTQETPFSLAYGLEAVIPIVTIIP 176 Score = 28.5 bits (62), Expect(3) = 6e-07 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -2 Query: 166 IGNNKSK*VGILSEVLWAYQSTPRRS 89 + + KS +L VLWAY++TPR+S Sbjct: 128 LDSKKSMWSDVLHGVLWAYRTTPRKS 153 >gb|AAG50898.1|AC068901_7 hypothetical protein [Arabidopsis thaliana] Length = 243 Score = 40.8 bits (94), Expect(3) = 6e-07 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = -3 Query: 276 FCNSHKIQQKFSNPKYTKGNGILDATNKAILEDIKK 169 FC+ KI+ S P Y +GNG +A NKAIL +IKK Sbjct: 77 FCDKWKIRLTTSTPHYPQGNGQAEAANKAILSNIKK 112 Score = 28.9 bits (63), Expect(3) = 6e-07 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 101 P*KITLESPFSLTYWMKTAIPTRMLIP 21 P K T E+PFSL Y ++ IP +IP Sbjct: 136 PRKSTQETPFSLAYGLEAVIPIVTIIP 162 Score = 28.5 bits (62), Expect(3) = 6e-07 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -2 Query: 166 IGNNKSK*VGILSEVLWAYQSTPRRS 89 + + KS +L VLWAY++TPR+S Sbjct: 114 LDSKKSMWSDVLHGVLWAYRTTPRKS 139 >gb|AAD03367.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1329 Score = 38.9 bits (89), Expect(3) = 9e-06 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = -3 Query: 336 PLAVFIGLGSSMHASMYSMPFCNSHKIQQKFSNPKYTKGNGILDATNKAILEDIKKR 166 P + GS + + + FC +I+ S P+Y +GNG +A NK I+ ++KK+ Sbjct: 1104 PYEIVTDNGSQFISEQFEV-FCEEWQIRLSHSTPRYPQGNGQAEAMNKTIISNLKKK 1159 Score = 28.5 bits (62), Expect(3) = 9e-06 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 101 P*KITLESPFSLTYWMKTAIPTRMLIP 21 P + T E+PFSL Y M+ IP + +P Sbjct: 1182 PRRATDETPFSLIYGMEAVIPAEIKVP 1208 Score = 26.6 bits (57), Expect(3) = 9e-06 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 172 EKIGNNKSK*VGILSEVLWAYQSTPRRS 89 +K+ K G L VLWA ++TPRR+ Sbjct: 1158 KKLNAYKGAWFGELQNVLWAVRTTPRRA 1185