BLASTX nr result
ID: Akebia25_contig00051916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00051916 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME43386.1| hypothetical protein DOTSEDRAFT_25336 [Dothistrom... 58 2e-06 >gb|EME43386.1| hypothetical protein DOTSEDRAFT_25336 [Dothistroma septosporum NZE10] Length = 84 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -1 Query: 316 SYQRLMHEHTKQQFELATSSARRRGSPPEHDISSLRNETSGMSIDSTSS 170 SYQR+MH+HTKQQFELAT+S+RRR S ISSL E+S S+ STSS Sbjct: 37 SYQRIMHQHTKQQFELATASSRRR-SANSGSISSLTPESSTGSMSSTSS 84