BLASTX nr result
ID: Akebia25_contig00051692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00051692 (473 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EQB52442.1| hypothetical protein CGLO_07925 [Colletotrichum g... 55 1e-05 >gb|EQB52442.1| hypothetical protein CGLO_07925 [Colletotrichum gloeosporioides Cg-14] Length = 625 Score = 55.1 bits (131), Expect = 1e-05 Identities = 40/127 (31%), Positives = 55/127 (43%), Gaps = 17/127 (13%) Frame = -2 Query: 472 QNGYQWGRHTPEP-FNPDHM---SSGRYTPEQAQAH-----------HSPQTSTTSTYR- 341 Q Y++GR P P +P + + G Y P+Q H H+P ++S Y Sbjct: 62 QPQYEYGRQQPYPQHSPAYAGQPTGGSYPPQQQWHHDHAHPTPQHGAHAPAPLSSSNYHP 121 Query: 340 NLIPRTTSPPQRAQSPTAME-YPPQHPYETSQPFVHPNPNIARAQSNSGRSAHEQWTAMQ 164 N P+ S PQ AQ P Y P P + QP+ HP P A Q ++G H Q Sbjct: 122 NYAPQVYSHPQHAQPPPHQPGYGPPQPQQYGQPYQHPAPYSAPQQWSAGHDQHAQNHYSG 181 Query: 163 NQGSGQY 143 +G G Y Sbjct: 182 GRGRGGY 188