BLASTX nr result
ID: Akebia25_contig00051690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00051690 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME39234.1| hypothetical protein DOTSEDRAFT_75082 [Dothistrom... 67 3e-09 gb|EME80107.1| hypothetical protein MYCFIDRAFT_208476 [Pseudocer... 67 3e-09 ref|XP_003851240.1| hypothetical protein MYCGRDRAFT_73769 [Zymos... 65 7e-09 gb|EMF09901.1| cyclin-domain-containing protein [Sphaerulina mus... 64 2e-08 >gb|EME39234.1| hypothetical protein DOTSEDRAFT_75082 [Dothistroma septosporum NZE10] Length = 496 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +1 Query: 1 AYGTMLVEFYAREVVAQQRAADAMEARSLSESSADSAATVQAAG 132 AYGTMLVEFYAREVVAQ++ A+ M+ARSLSESS DS +TV+A G Sbjct: 453 AYGTMLVEFYAREVVAQKQLAEVMQARSLSESSEDSTSTVRAVG 496 >gb|EME80107.1| hypothetical protein MYCFIDRAFT_208476 [Pseudocercospora fijiensis CIRAD86] Length = 693 Score = 66.6 bits (161), Expect = 3e-09 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 6/50 (12%) Frame = +1 Query: 1 AYGTMLVEFYAREVVAQQRAADA------MEARSLSESSADSAATVQAAG 132 AYGTMLVEFYAREVVAQQ+AADA M+ARSLSESS +S ATV+A G Sbjct: 580 AYGTMLVEFYAREVVAQQKAADAAREQQMMQARSLSESSNESTATVRAVG 629 >ref|XP_003851240.1| hypothetical protein MYCGRDRAFT_73769 [Zymoseptoria tritici IPO323] gi|339471119|gb|EGP86216.1| hypothetical protein MYCGRDRAFT_73769 [Zymoseptoria tritici IPO323] Length = 290 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/42 (73%), Positives = 41/42 (97%) Frame = +1 Query: 1 AYGTMLVEFYAREVVAQQRAADAMEARSLSESSADSAATVQA 126 AYGTMLVEFYAREVVAQ++A+++M+ RSLSE+S+DSA+TV+A Sbjct: 247 AYGTMLVEFYAREVVAQKQASESMQTRSLSETSSDSASTVRA 288 >gb|EMF09901.1| cyclin-domain-containing protein [Sphaerulina musiva SO2202] Length = 494 Score = 63.9 bits (154), Expect = 2e-08 Identities = 35/47 (74%), Positives = 39/47 (82%), Gaps = 3/47 (6%) Frame = +1 Query: 1 AYGTMLVEFYAREVVAQQRAADA---MEARSLSESSADSAATVQAAG 132 AYGTMLVEFYAREVVAQ+RAA+A M RSLSESS +S ATV+A G Sbjct: 448 AYGTMLVEFYAREVVAQKRAAEAAASMNERSLSESSTESTATVRAVG 494