BLASTX nr result
ID: Akebia25_contig00051341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00051341 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007012258.1| N-MYC downregulated-like 2 isoform 1 [Theobr... 57 2e-06 ref|XP_002516460.1| pollen specific protein sf21, putative [Rici... 57 2e-06 ref|XP_002277611.1| PREDICTED: pollen-specific protein SF21 [Vit... 57 4e-06 ref|XP_002514154.1| pollen specific protein sf21, putative [Rici... 56 5e-06 >ref|XP_007012258.1| N-MYC downregulated-like 2 isoform 1 [Theobroma cacao] gi|508782621|gb|EOY29877.1| N-MYC downregulated-like 2 isoform 1 [Theobroma cacao] Length = 346 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 405 VGENSPFHSEALHMTVKLDRRYSALVEVR 319 VGENSPFHSEALHMT KLDRRYSALVEV+ Sbjct: 248 VGENSPFHSEALHMTSKLDRRYSALVEVQ 276 >ref|XP_002516460.1| pollen specific protein sf21, putative [Ricinus communis] gi|223544280|gb|EEF45801.1| pollen specific protein sf21, putative [Ricinus communis] Length = 347 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 405 VGENSPFHSEALHMTVKLDRRYSALVEVR 319 VGENSPFHSEALHMT KLDRRYSALVEV+ Sbjct: 248 VGENSPFHSEALHMTSKLDRRYSALVEVQ 276 >ref|XP_002277611.1| PREDICTED: pollen-specific protein SF21 [Vitis vinifera] gi|296081622|emb|CBI20627.3| unnamed protein product [Vitis vinifera] Length = 344 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 405 VGENSPFHSEALHMTVKLDRRYSALVEVRN 316 VG+NSPFHSEALHMT KLDRRYSALVEV++ Sbjct: 248 VGDNSPFHSEALHMTSKLDRRYSALVEVQS 277 >ref|XP_002514154.1| pollen specific protein sf21, putative [Ricinus communis] gi|223546610|gb|EEF48108.1| pollen specific protein sf21, putative [Ricinus communis] Length = 295 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 405 VGENSPFHSEALHMTVKLDRRYSALVEVR 319 VG+NSPFHSEALHMT KLDRRYSALVEV+ Sbjct: 248 VGDNSPFHSEALHMTSKLDRRYSALVEVQ 276