BLASTX nr result
ID: Akebia25_contig00051161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00051161 (220 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266664.2| PREDICTED: LOW QUALITY PROTEIN: GATA transcr... 68 1e-09 emb|CAN72981.1| hypothetical protein VITISV_009032 [Vitis vinifera] 68 1e-09 ref|XP_002521591.1| GATA transcription factor, putative [Ricinus... 65 1e-08 ref|XP_007046928.1| GATA type zinc finger transcription factor f... 63 4e-08 ref|XP_006466800.1| PREDICTED: GATA transcription factor 18-like... 62 8e-08 ref|XP_006425668.1| hypothetical protein CICLE_v10026328mg [Citr... 62 8e-08 ref|XP_006340931.1| PREDICTED: GATA transcription factor 18-like... 60 4e-07 ref|XP_004233721.1| PREDICTED: GATA transcription factor 18-like... 60 4e-07 ref|XP_002310237.2| MONOPOLE family protein [Populus trichocarpa... 59 5e-07 ref|XP_006383192.1| hypothetical protein POPTR_0005s12440g [Popu... 57 2e-06 ref|XP_004512046.1| PREDICTED: GATA transcription factor 18-like... 57 3e-06 ref|XP_007202952.1| hypothetical protein PRUPE_ppa014930mg [Prun... 55 8e-06 >ref|XP_002266664.2| PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 18-like [Vitis vinifera] Length = 294 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +2 Query: 38 STPFGNEFRFIEDNDGESDTSLPFLSWRLNVPDSRPSLVHDYT 166 S GNEFRFIED+D +SDT +PFLSWRLNV D RPSLVHD+T Sbjct: 252 SPAMGNEFRFIEDDDRDSDTGIPFLSWRLNVTD-RPSLVHDFT 293 >emb|CAN72981.1| hypothetical protein VITISV_009032 [Vitis vinifera] Length = 324 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +2 Query: 38 STPFGNEFRFIEDNDGESDTSLPFLSWRLNVPDSRPSLVHDYT 166 S GNEFRFIED+D +SDT +PFLSWRLNV D RPSLVHD+T Sbjct: 282 SPAMGNEFRFIEDDDRDSDTGIPFLSWRLNVTD-RPSLVHDFT 323 >ref|XP_002521591.1| GATA transcription factor, putative [Ricinus communis] gi|223539269|gb|EEF40862.1| GATA transcription factor, putative [Ricinus communis] Length = 332 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +2 Query: 53 NEFRFIEDNDGESDTSLPFLSWRLNVPDSRPSLVHDYT 166 NEFRFIED+D +SDT +PFLSWRLNV D RPSLVHD+T Sbjct: 295 NEFRFIEDSDRDSDTGIPFLSWRLNVTD-RPSLVHDFT 331 >ref|XP_007046928.1| GATA type zinc finger transcription factor family protein [Theobroma cacao] gi|508699189|gb|EOX91085.1| GATA type zinc finger transcription factor family protein [Theobroma cacao] Length = 249 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +2 Query: 53 NEFRFIEDNDGESDTSLPFLSWRLNVPDSRPSLVHDYT 166 NEFRFIED D +SDT +PFLSWRLNV D SLVHD+T Sbjct: 211 NEFRFIEDTDRDSDTGIPFLSWRLNVTDRPTSLVHDFT 248 >ref|XP_006466800.1| PREDICTED: GATA transcription factor 18-like [Citrus sinensis] Length = 244 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 53 NEFRFIEDNDGESDTSLPFLSWRLNVPDSRPSLVHDYT 166 NEFRFIED+D SDT +PFLSWRLNV D RP LVHD+T Sbjct: 207 NEFRFIEDSDQTSDTGVPFLSWRLNVAD-RPGLVHDFT 243 >ref|XP_006425668.1| hypothetical protein CICLE_v10026328mg [Citrus clementina] gi|557527658|gb|ESR38908.1| hypothetical protein CICLE_v10026328mg [Citrus clementina] Length = 255 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 53 NEFRFIEDNDGESDTSLPFLSWRLNVPDSRPSLVHDYT 166 NEFRFIED+D SDT +PFLSWRLNV D RP LVHD+T Sbjct: 218 NEFRFIEDSDQTSDTGVPFLSWRLNVAD-RPGLVHDFT 254 >ref|XP_006340931.1| PREDICTED: GATA transcription factor 18-like [Solanum tuberosum] Length = 247 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 5/49 (10%) Frame = +2 Query: 35 SSTPFGNEFRFIEDNDGESD-----TSLPFLSWRLNVPDSRPSLVHDYT 166 SS +GNEFRFIEDN+ D T++PF WRLNV D RPSLVHD+T Sbjct: 199 SSATYGNEFRFIEDNEHHRDSDAAATAIPFFPWRLNVAD-RPSLVHDFT 246 >ref|XP_004233721.1| PREDICTED: GATA transcription factor 18-like [Solanum lycopersicum] Length = 252 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 5/49 (10%) Frame = +2 Query: 35 SSTPFGNEFRFIEDNDGESD-----TSLPFLSWRLNVPDSRPSLVHDYT 166 SS +GNEFRFIEDN+ D T++PF WRLNV D RPSLVHD+T Sbjct: 204 SSASYGNEFRFIEDNEHHRDSDAAATAIPFFPWRLNVAD-RPSLVHDFT 251 >ref|XP_002310237.2| MONOPOLE family protein [Populus trichocarpa] gi|550334761|gb|EEE90687.2| MONOPOLE family protein [Populus trichocarpa] Length = 254 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = +2 Query: 53 NEFRFIEDNDGESDT--SLPFLSWRLNVPDSRPSLVHDYT 166 NEFRFIEDND +SDT ++PFLSWRLNV D LVHD+T Sbjct: 213 NEFRFIEDNDRDSDTGNNIPFLSWRLNVTDRPSQLVHDFT 252 >ref|XP_006383192.1| hypothetical protein POPTR_0005s12440g [Populus trichocarpa] gi|550338774|gb|ERP60989.1| hypothetical protein POPTR_0005s12440g [Populus trichocarpa] Length = 254 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = +2 Query: 53 NEFRFIEDNDGESDT-SLPFLSWRLNVPDSRPSLVHDYT 166 NEF FIEDND +SDT ++PFLSWRLNV D LVHD+T Sbjct: 214 NEFSFIEDNDRDSDTGNIPFLSWRLNVTDRPSQLVHDFT 252 >ref|XP_004512046.1| PREDICTED: GATA transcription factor 18-like [Cicer arietinum] Length = 245 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +2 Query: 38 STPFGNEFRFIEDNDGESDTSLPFLSWRLNVPDSRPSLVHDYT 166 S NEFRF+++ D ESD +PFLSWRLNV D R S VHD+T Sbjct: 203 SPAMSNEFRFVDETDRESDNGIPFLSWRLNVTD-RTSFVHDFT 244 >ref|XP_007202952.1| hypothetical protein PRUPE_ppa014930mg [Prunus persica] gi|462398483|gb|EMJ04151.1| hypothetical protein PRUPE_ppa014930mg [Prunus persica] Length = 281 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/46 (60%), Positives = 33/46 (71%), Gaps = 3/46 (6%) Frame = +2 Query: 38 STPFGNEFRFIEDNDGESD---TSLPFLSWRLNVPDSRPSLVHDYT 166 S GNEFRF+ED+ + T +PFLSWRLNV D RPSLVHD+T Sbjct: 236 SPAMGNEFRFMEDDTAHHENDATGIPFLSWRLNVTD-RPSLVHDFT 280