BLASTX nr result
ID: Akebia25_contig00050817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00050817 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EHY61189.1| hypothetical protein HMPREF1120_09125 [Exophiala ... 57 2e-06 >gb|EHY61189.1| hypothetical protein HMPREF1120_09125 [Exophiala dermatitidis NIH/UT8656] Length = 208 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/57 (43%), Positives = 35/57 (61%) Frame = -1 Query: 200 MTGTFSYHGASLKGDPKWAEVSRWTGKAPLLVLNIWVFAILETILGAVWISQLGSNM 30 M G AS KGDP+W S+WTG P +VL + V +++E LGAVWIS + + + Sbjct: 1 MLGIQGLADASFKGDPRWKRASKWTGYGPWIVLTLAVLSMIEIALGAVWISSMKTEL 57