BLASTX nr result
ID: Akebia25_contig00050572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00050572 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270439.2| PREDICTED: pentatricopeptide repeat-containi... 120 2e-25 emb|CBI17228.3| unnamed protein product [Vitis vinifera] 120 2e-25 ref|XP_007034318.1| Tetratricopeptide repeat-like superfamily pr... 117 1e-24 ref|XP_004139010.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 ref|XP_006360955.1| PREDICTED: pentatricopeptide repeat-containi... 111 1e-22 ref|XP_004247960.1| PREDICTED: pentatricopeptide repeat-containi... 111 1e-22 gb|ADE77588.1| unknown [Picea sitchensis] 111 1e-22 ref|XP_002867196.1| pentatricopeptide repeat-containing protein ... 109 3e-22 ref|NP_195043.1| pentatricopeptide repeat-containing protein [Ar... 108 6e-22 ref|XP_004301739.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 emb|CBI24272.3| unnamed protein product [Vitis vinifera] 107 1e-21 ref|XP_002265253.1| PREDICTED: pentatricopeptide repeat-containi... 107 1e-21 ref|XP_004233812.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 emb|CBI20738.3| unnamed protein product [Vitis vinifera] 107 2e-21 emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] 107 2e-21 ref|XP_006477110.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_006347159.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_006440204.1| hypothetical protein CICLE_v10019492mg [Citr... 107 2e-21 gb|AEX11740.1| hypothetical protein 0_16763_01 [Pinus taeda] gi|... 106 3e-21 >ref|XP_002270439.2| PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Vitis vinifera] Length = 677 Score = 120 bits (301), Expect = 2e-25 Identities = 55/68 (80%), Positives = 60/68 (88%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLALAFGLIST G+ IRIVKNLRVCGDCH++MKYAS +REIILRDIKRFH FKDG Sbjct: 610 SEKLALAFGLISTAPGSTIRIVKNLRVCGDCHSMMKYASKLSRREIILRDIKRFHHFKDG 669 Query: 29 VCTCGDYW 6 C+CGDYW Sbjct: 670 TCSCGDYW 677 >emb|CBI17228.3| unnamed protein product [Vitis vinifera] Length = 590 Score = 120 bits (301), Expect = 2e-25 Identities = 55/68 (80%), Positives = 60/68 (88%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLALAFGLIST G+ IRIVKNLRVCGDCH++MKYAS +REIILRDIKRFH FKDG Sbjct: 523 SEKLALAFGLISTAPGSTIRIVKNLRVCGDCHSMMKYASKLSRREIILRDIKRFHHFKDG 582 Query: 29 VCTCGDYW 6 C+CGDYW Sbjct: 583 TCSCGDYW 590 >ref|XP_007034318.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|590656608|ref|XP_007034319.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|590656611|ref|XP_007034320.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|590656614|ref|XP_007034321.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508713347|gb|EOY05244.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508713348|gb|EOY05245.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508713349|gb|EOY05246.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508713350|gb|EOY05247.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 682 Score = 117 bits (294), Expect = 1e-24 Identities = 53/68 (77%), Positives = 58/68 (85%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLALAF LI T GT IRIVKNLRVCGDCH++MKYAS +REI+LRDIKRFH FKDG Sbjct: 615 SEKLALAFALIRTSPGTTIRIVKNLRVCGDCHSLMKYASKMSQREIVLRDIKRFHHFKDG 674 Query: 29 VCTCGDYW 6 C+CGDYW Sbjct: 675 ACSCGDYW 682 >ref|XP_004139010.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Cucumis sativus] gi|449505311|ref|XP_004162432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Cucumis sativus] Length = 679 Score = 117 bits (292), Expect = 2e-24 Identities = 52/68 (76%), Positives = 58/68 (85%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLALAFG++ST GT +RIVKNLRVC DCH+ MKYAS KREIILRD+KRFH F DG Sbjct: 612 SEKLALAFGIVSTRPGTTVRIVKNLRVCVDCHSFMKYASKMSKREIILRDMKRFHHFNDG 671 Query: 29 VCTCGDYW 6 VC+CGDYW Sbjct: 672 VCSCGDYW 679 >ref|XP_006360955.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like isoform X1 [Solanum tuberosum] gi|565390461|ref|XP_006360956.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like isoform X2 [Solanum tuberosum] Length = 666 Score = 111 bits (277), Expect = 1e-22 Identities = 51/68 (75%), Positives = 56/68 (82%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLALAFGLIST G I IVKNLRVCGDCH++MKY S +R I+LRDIKRFH FKDG Sbjct: 599 SEKLALAFGLISTGPGVIIMIVKNLRVCGDCHSLMKYVSRMSQRVIVLRDIKRFHHFKDG 658 Query: 29 VCTCGDYW 6 VC+C DYW Sbjct: 659 VCSCKDYW 666 >ref|XP_004247960.1| PREDICTED: pentatricopeptide repeat-containing protein At1g04840-like [Solanum lycopersicum] Length = 547 Score = 111 bits (277), Expect = 1e-22 Identities = 51/68 (75%), Positives = 56/68 (82%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLALAFGLIST G I IVKNLRVCGDCH++MKY S +R I+LRDIKRFH FKDG Sbjct: 480 SEKLALAFGLISTGPGVIIMIVKNLRVCGDCHSLMKYVSRMSQRVIVLRDIKRFHHFKDG 539 Query: 29 VCTCGDYW 6 VC+C DYW Sbjct: 540 VCSCKDYW 547 >gb|ADE77588.1| unknown [Picea sitchensis] Length = 312 Score = 111 bits (277), Expect = 1e-22 Identities = 49/68 (72%), Positives = 57/68 (83%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLA+AFGLIST GT+IRI KNLRVCGDCH+ K+ S KREII+RD+ RFH FKDG Sbjct: 245 SEKLAIAFGLISTRSGTSIRITKNLRVCGDCHSATKFISKIVKREIIMRDLNRFHHFKDG 304 Query: 29 VCTCGDYW 6 +C+CGDYW Sbjct: 305 LCSCGDYW 312 >ref|XP_002867196.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313032|gb|EFH43455.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 997 Score = 109 bits (273), Expect = 3e-22 Identities = 48/68 (70%), Positives = 55/68 (80%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLA+AFGL+ST T IR++KNLRVCGDCH MKY S REI+LRD RFHRFKDG Sbjct: 930 SEKLAVAFGLLSTPPSTPIRVIKNLRVCGDCHNAMKYISKVYDREIVLRDANRFHRFKDG 989 Query: 29 VCTCGDYW 6 +C+CGDYW Sbjct: 990 ICSCGDYW 997 >ref|NP_195043.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206840|sp|Q9SMZ2.1|PP347_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g33170 gi|4455331|emb|CAB36791.1| putative protein [Arabidopsis thaliana] gi|7270265|emb|CAB80034.1| putative protein [Arabidopsis thaliana] gi|332660786|gb|AEE86186.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 990 Score = 108 bits (271), Expect = 6e-22 Identities = 47/68 (69%), Positives = 55/68 (80%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLA+AFGL+ST T IR++KNLRVCGDCH MKY + REI+LRD RFHRFKDG Sbjct: 923 SEKLAVAFGLLSTPPSTPIRVIKNLRVCGDCHNAMKYIAKVYNREIVLRDANRFHRFKDG 982 Query: 29 VCTCGDYW 6 +C+CGDYW Sbjct: 983 ICSCGDYW 990 >ref|XP_004301739.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 669 Score = 108 bits (269), Expect = 1e-21 Identities = 49/68 (72%), Positives = 56/68 (82%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLA+AFGLI GT IRI KNLRVCGDCH +KY S+ +KREIILRD RFH+FK+G Sbjct: 602 SEKLAIAFGLIHVPSGTPIRIFKNLRVCGDCHHAIKYISVIEKREIILRDTTRFHQFKNG 661 Query: 29 VCTCGDYW 6 VC+CGDYW Sbjct: 662 VCSCGDYW 669 >emb|CBI24272.3| unnamed protein product [Vitis vinifera] Length = 729 Score = 107 bits (268), Expect = 1e-21 Identities = 47/68 (69%), Positives = 56/68 (82%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEK+ALAFGLIST GT +RI+KNLRVCGDCH+ K+ S +KR+II+RD RFH F DG Sbjct: 662 SEKIALAFGLISTTAGTPLRIIKNLRVCGDCHSATKFISKVEKRDIIMRDNYRFHHFVDG 721 Query: 29 VCTCGDYW 6 VC+CGDYW Sbjct: 722 VCSCGDYW 729 >ref|XP_002265253.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Vitis vinifera] Length = 972 Score = 107 bits (268), Expect = 1e-21 Identities = 47/68 (69%), Positives = 56/68 (82%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEK+ALAFGLIST GT +RI+KNLRVCGDCH+ K+ S +KR+II+RD RFH F DG Sbjct: 905 SEKIALAFGLISTTAGTPLRIIKNLRVCGDCHSATKFISKVEKRDIIMRDNYRFHHFVDG 964 Query: 29 VCTCGDYW 6 VC+CGDYW Sbjct: 965 VCSCGDYW 972 >ref|XP_004233812.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Solanum lycopersicum] Length = 811 Score = 107 bits (267), Expect = 2e-21 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLA+ FGL++T GT I I KNLRVCGDCH KY S+ KREII+RD+ RFH FKDG Sbjct: 744 SEKLAIVFGLLNTSAGTTIHIRKNLRVCGDCHTATKYISLVMKREIIVRDMHRFHHFKDG 803 Query: 29 VCTCGDYW 6 VC+CGDYW Sbjct: 804 VCSCGDYW 811 >ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Vitis vinifera] Length = 1580 Score = 107 bits (267), Expect = 2e-21 Identities = 46/68 (67%), Positives = 55/68 (80%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLA+A+GLIST T IR++KNLRVCGDCH +KY S +REI+LRD RFH F+DG Sbjct: 1513 SEKLAIAYGLISTPASTTIRVIKNLRVCGDCHNAIKYISKVFEREIVLRDANRFHHFRDG 1572 Query: 29 VCTCGDYW 6 VC+CGDYW Sbjct: 1573 VCSCGDYW 1580 >emb|CBI20738.3| unnamed protein product [Vitis vinifera] Length = 865 Score = 107 bits (267), Expect = 2e-21 Identities = 46/68 (67%), Positives = 55/68 (80%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLA+A+GLIST T IR++KNLRVCGDCH +KY S +REI+LRD RFH F+DG Sbjct: 798 SEKLAIAYGLISTPASTTIRVIKNLRVCGDCHNAIKYISKVFEREIVLRDANRFHHFRDG 857 Query: 29 VCTCGDYW 6 VC+CGDYW Sbjct: 858 VCSCGDYW 865 >emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] Length = 503 Score = 107 bits (267), Expect = 2e-21 Identities = 46/68 (67%), Positives = 55/68 (80%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLA+A+GLIST T IR++KNLRVCGDCH +KY S +REI+LRD RFH F+DG Sbjct: 436 SEKLAIAYGLISTPASTTIRVIKNLRVCGDCHNAIKYISKVFEREIVLRDANRFHHFRDG 495 Query: 29 VCTCGDYW 6 VC+CGDYW Sbjct: 496 VCSCGDYW 503 >ref|XP_006477110.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Citrus sinensis] Length = 669 Score = 107 bits (266), Expect = 2e-21 Identities = 47/68 (69%), Positives = 53/68 (77%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLA+AFGLI +GT IR+ KNLRVCGDCH KY S +KREII+RD RFH FKDG Sbjct: 602 SEKLAIAFGLIKVPLGTPIRVFKNLRVCGDCHRATKYISAIEKREIIVRDTTRFHHFKDG 661 Query: 29 VCTCGDYW 6 C+CGDYW Sbjct: 662 TCSCGDYW 669 >ref|XP_006347159.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Solanum tuberosum] Length = 809 Score = 107 bits (266), Expect = 2e-21 Identities = 47/68 (69%), Positives = 55/68 (80%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLA+AFGL++T GT I I KNLRVCGDCH KY S+ KREII+RD+ RFH FK+G Sbjct: 742 SEKLAIAFGLLNTSAGTTIHIRKNLRVCGDCHTATKYISLVMKREIIVRDMHRFHHFKNG 801 Query: 29 VCTCGDYW 6 VC+CGDYW Sbjct: 802 VCSCGDYW 809 >ref|XP_006440204.1| hypothetical protein CICLE_v10019492mg [Citrus clementina] gi|557542466|gb|ESR53444.1| hypothetical protein CICLE_v10019492mg [Citrus clementina] Length = 571 Score = 107 bits (266), Expect = 2e-21 Identities = 47/68 (69%), Positives = 53/68 (77%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SEKLA+AFGLI +GT IR+ KNLRVCGDCH KY S +KREII+RD RFH FKDG Sbjct: 504 SEKLAIAFGLIKVPLGTPIRVFKNLRVCGDCHRATKYISAIEKREIIVRDTTRFHHFKDG 563 Query: 29 VCTCGDYW 6 C+CGDYW Sbjct: 564 TCSCGDYW 571 >gb|AEX11740.1| hypothetical protein 0_16763_01 [Pinus taeda] gi|367062922|gb|AEX11743.1| hypothetical protein 0_16763_01 [Pinus taeda] gi|367062926|gb|AEX11745.1| hypothetical protein 0_16763_01 [Pinus taeda] Length = 119 Score = 106 bits (265), Expect = 3e-21 Identities = 44/68 (64%), Positives = 57/68 (83%) Frame = -3 Query: 209 SEKLALAFGLISTHVGTAIRIVKNLRVCGDCHAIMKYASMTDKREIILRDIKRFHRFKDG 30 SE+ A+AFGL++T GT +RI+KNLRVCGDCH+ MKY S +REI++RD RFHRF+DG Sbjct: 52 SERQAIAFGLLNTSPGTPLRIIKNLRVCGDCHSAMKYISNIAEREIVMRDANRFHRFRDG 111 Query: 29 VCTCGDYW 6 +C+CGDYW Sbjct: 112 LCSCGDYW 119