BLASTX nr result
ID: Akebia25_contig00050272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00050272 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUN29969.1| hypothetical protein COCVIDRAFT_35327 [Bipolaris ... 70 4e-10 gb|EUC39011.1| hypothetical protein COCCADRAFT_421 [Bipolaris ze... 70 4e-10 gb|EHY57666.1| hypothetical protein HMPREF1120_05694 [Exophiala ... 67 3e-09 gb|ETN43217.1| hypothetical protein HMPREF1541_02376 [Cyphelloph... 65 8e-09 gb|EQL31280.1| hypothetical protein, variant 3 [Ajellomyces derm... 65 8e-09 gb|EQL31277.1| hypothetical protein BDFG_06338 [Ajellomyces derm... 65 8e-09 gb|EGE79918.1| hypothetical protein BDDG_02859 [Ajellomyces derm... 65 8e-09 gb|EEQ84096.1| conserved hypothetical protein [Ajellomyces derma... 65 8e-09 ref|XP_002626945.1| conserved hypothetical protein [Ajellomyces ... 65 8e-09 gb|EUC43230.1| hypothetical protein COCMIDRAFT_101462 [Bipolaris... 64 2e-08 gb|EMD96107.1| hypothetical protein COCHEDRAFT_1166976 [Bipolari... 64 2e-08 gb|EMD69165.1| hypothetical protein COCSADRAFT_105358 [Bipolaris... 64 2e-08 gb|EKG10979.1| hypothetical protein MPH_11982 [Macrophomina phas... 64 3e-08 gb|EXJ89017.1| hypothetical protein A1O3_02081 [Capronia epimyce... 63 4e-08 gb|EXJ63959.1| hypothetical protein A1O7_00294 [Cladophialophora... 63 5e-08 ref|XP_003296177.1| hypothetical protein PTT_05274 [Pyrenophora ... 62 6e-08 gb|EEH44514.1| conserved hypothetical protein [Paracoccidioides ... 62 1e-07 ref|XP_002796203.1| conserved hypothetical protein [Paracoccidio... 62 1e-07 gb|EEH20080.1| conserved hypothetical protein [Paracoccidioides ... 62 1e-07 gb|ETI27869.1| hypothetical protein G647_00318 [Cladophialophora... 61 1e-07 >gb|EUN29969.1| hypothetical protein COCVIDRAFT_35327 [Bipolaris victoriae FI3] Length = 481 Score = 69.7 bits (169), Expect = 4e-10 Identities = 28/50 (56%), Positives = 40/50 (80%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECL 24 +PNPFRR T NTR WGYS+E TP+H+T +QMK ++++YD A++CL+ L Sbjct: 3 LPNPFRRRTANTRYCWGYSFEWTPEHLTQEQMKPMKFSYDVLAEECLDRL 52 >gb|EUC39011.1| hypothetical protein COCCADRAFT_421 [Bipolaris zeicola 26-R-13] Length = 481 Score = 69.7 bits (169), Expect = 4e-10 Identities = 28/50 (56%), Positives = 40/50 (80%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECL 24 +PNPFRR T NTR WGYS+E TP+H+T +QMK ++++YD A++CL+ L Sbjct: 3 LPNPFRRRTANTRYCWGYSFEWTPEHLTQEQMKPMKFSYDVLAEECLDRL 52 >gb|EHY57666.1| hypothetical protein HMPREF1120_05694 [Exophiala dermatitidis NIH/UT8656] Length = 472 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = -2 Query: 170 PNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 PNPFRR NTR WGY+++ TPQH+T +Q L+Y+YD ++C E L EL Sbjct: 4 PNPFRRRDENTRTYWGYTFQLTPQHLTAEQAHPLKYSYDVLGEECYEILNEL 55 >gb|ETN43217.1| hypothetical protein HMPREF1541_02376 [Cyphellophora europaea CBS 101466] Length = 482 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -2 Query: 170 PNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 PNPFRR NTR WGY+++ TP+HMT++Q L+++YD ++CL+ L EL Sbjct: 4 PNPFRRRDENTRTCWGYTFQLTPEHMTLEQSHPLKHSYDVLGEECLDILNEL 55 >gb|EQL31280.1| hypothetical protein, variant 3 [Ajellomyces dermatitidis ATCC 26199] Length = 475 Score = 65.5 bits (158), Expect = 8e-09 Identities = 25/53 (47%), Positives = 41/53 (77%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 +PN FRR+ NTR WGYS++ TP+H++ +QM+ ++++YD+ AD+CL L E+ Sbjct: 3 IPNLFRRSDENTRTAWGYSFQWTPEHLSGEQMEPMKHSYDRLADECLTRLNEI 55 >gb|EQL31277.1| hypothetical protein BDFG_06338 [Ajellomyces dermatitidis ATCC 26199] gi|531980691|gb|EQL31278.1| hypothetical protein, variant 1 [Ajellomyces dermatitidis ATCC 26199] gi|531980692|gb|EQL31279.1| hypothetical protein, variant 2 [Ajellomyces dermatitidis ATCC 26199] Length = 543 Score = 65.5 bits (158), Expect = 8e-09 Identities = 25/53 (47%), Positives = 41/53 (77%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 +PN FRR+ NTR WGYS++ TP+H++ +QM+ ++++YD+ AD+CL L E+ Sbjct: 71 IPNLFRRSDENTRTAWGYSFQWTPEHLSGEQMEPMKHSYDRLADECLTRLNEI 123 >gb|EGE79918.1| hypothetical protein BDDG_02859 [Ajellomyces dermatitidis ATCC 18188] Length = 475 Score = 65.5 bits (158), Expect = 8e-09 Identities = 25/53 (47%), Positives = 41/53 (77%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 +PN FRR+ NTR WGYS++ TP+H++ +QM+ ++++YD+ AD+CL L E+ Sbjct: 3 IPNLFRRSDENTRTAWGYSFQWTPEHLSGEQMEPMKHSYDRLADECLTRLNEI 55 >gb|EEQ84096.1| conserved hypothetical protein [Ajellomyces dermatitidis ER-3] Length = 448 Score = 65.5 bits (158), Expect = 8e-09 Identities = 25/53 (47%), Positives = 41/53 (77%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 +PN FRR+ NTR WGYS++ TP+H++ +QM+ ++++YD+ AD+CL L E+ Sbjct: 3 IPNLFRRSDENTRTAWGYSFQWTPEHLSGEQMEPMKHSYDRLADECLTRLNEI 55 >ref|XP_002626945.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] gi|239594017|gb|EEQ76598.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] Length = 448 Score = 65.5 bits (158), Expect = 8e-09 Identities = 25/53 (47%), Positives = 41/53 (77%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 +PN FRR+ NTR WGYS++ TP+H++ +QM+ ++++YD+ AD+CL L E+ Sbjct: 3 IPNLFRRSDENTRTAWGYSFQWTPEHLSGEQMEPMKHSYDRLADECLTRLNEI 55 >gb|EUC43230.1| hypothetical protein COCMIDRAFT_101462 [Bipolaris oryzae ATCC 44560] Length = 481 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/50 (52%), Positives = 39/50 (78%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECL 24 +PN F+R T NTR WGYS+E TP+H+T +QMK ++++YD A++CL+ L Sbjct: 3 LPNLFQRRTANTRYCWGYSFEWTPEHLTPEQMKPMKFSYDVLAEECLDRL 52 >gb|EMD96107.1| hypothetical protein COCHEDRAFT_1166976 [Bipolaris maydis C5] gi|477593897|gb|ENI10966.1| hypothetical protein COCC4DRAFT_184284 [Bipolaris maydis ATCC 48331] Length = 481 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/50 (52%), Positives = 39/50 (78%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECL 24 +PN F+R T NTR WGYS+E TP+H+T +QMK ++++YD A++CL+ L Sbjct: 3 LPNLFQRRTANTRYCWGYSFEWTPEHLTPEQMKPMKFSYDVLAEECLDRL 52 >gb|EMD69165.1| hypothetical protein COCSADRAFT_105358 [Bipolaris sorokiniana ND90Pr] Length = 481 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/50 (52%), Positives = 39/50 (78%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECL 24 +PN F+R T NTR WGYS+E TP+H+T +QMK ++++YD A++CL+ L Sbjct: 3 LPNLFQRRTANTRYCWGYSFEWTPEHLTPEQMKPMKFSYDVLAEECLDRL 52 >gb|EKG10979.1| hypothetical protein MPH_11982 [Macrophomina phaseolina MS6] Length = 493 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/52 (46%), Positives = 39/52 (75%) Frame = -2 Query: 170 PNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 PNPFRR NTR+ WGY+++ TP+H++ +QM L+Y+YD ++CL+ L ++ Sbjct: 4 PNPFRRHNENTRSPWGYTFDLTPEHLSPEQMLPLKYSYDVLGEECLQRLNQI 55 >gb|EXJ89017.1| hypothetical protein A1O3_02081 [Capronia epimyces CBS 606.96] Length = 470 Score = 63.2 bits (152), Expect = 4e-08 Identities = 24/54 (44%), Positives = 37/54 (68%) Frame = -2 Query: 170 PNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYELQA 9 PNPFRR NTR WGY+++ TP+H+T +Q L+YTYD ++C + L ++ + Sbjct: 4 PNPFRRKDENTRTCWGYTFQLTPEHLTPEQAHPLKYTYDVLGEECYDILNQISS 57 >gb|EXJ63959.1| hypothetical protein A1O7_00294 [Cladophialophora yegresii CBS 114405] Length = 488 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/55 (43%), Positives = 38/55 (69%) Frame = -2 Query: 170 PNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYELQAK 6 PNPFRR NTR WGY+++ TP+H+T +Q + L+++YD ++C E L ++ K Sbjct: 4 PNPFRRRDENTRTCWGYTFQLTPEHLTPEQAQPLKFSYDVLGEECYEILDQMSRK 58 >ref|XP_003296177.1| hypothetical protein PTT_05274 [Pyrenophora teres f. teres 0-1] gi|311331891|gb|EFQ95729.1| hypothetical protein PTT_05274 [Pyrenophora teres f. teres 0-1] Length = 481 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/53 (47%), Positives = 37/53 (69%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 +PNPF+R T NT+ WGY +E TP H+T +QMK ++++YD + CL+ L L Sbjct: 3 LPNPFQRRTANTKNCWGYRFEWTPDHLTPEQMKPMKFSYDVLGEQCLDRLNAL 55 >gb|EEH44514.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb18] Length = 482 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/53 (45%), Positives = 38/53 (71%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 +PN FR + NTR WGYS++ T H+T ++M+ ++YTYD+ D+CL+ L E+ Sbjct: 3 LPNLFRSSDENTRTSWGYSFQWTEDHLTPEKMEPMKYTYDRLGDECLKRLNEI 55 >ref|XP_002796203.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] gi|226284336|gb|EEH39902.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 469 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/53 (45%), Positives = 38/53 (71%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 +PN FR + NTR WGYS++ T H+T ++M+ ++YTYD+ D+CL+ L E+ Sbjct: 3 LPNLFRSSDENTRTSWGYSFQWTADHLTPEKMEPMKYTYDRLGDECLKRLNEI 55 >gb|EEH20080.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03] Length = 449 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/53 (45%), Positives = 38/53 (71%) Frame = -2 Query: 173 VPNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 +PN FR + NTR WGYS++ T H+T ++M+ ++YTYD+ D+CL+ L E+ Sbjct: 3 LPNLFRSSDENTRTSWGYSFQWTEDHLTPEKMEPMKYTYDRLGDECLKRLNEI 55 >gb|ETI27869.1| hypothetical protein G647_00318 [Cladophialophora carrionii CBS 160.54] Length = 482 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/52 (44%), Positives = 37/52 (71%) Frame = -2 Query: 170 PNPFRRATPNTRARWGYSYEETPQHMTVDQMKALRYTYDKAADDCLECLYEL 15 PNPFRR NTR WGY+++ TP+H+T +Q + L+++YD ++C E L ++ Sbjct: 4 PNPFRRRDENTRTCWGYTFQLTPEHLTPEQAQPLKFSYDVLGEECYEILDQM 55