BLASTX nr result
ID: Akebia25_contig00049904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00049904 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME85838.1| hypothetical protein MYCFIDRAFT_150893 [Pseudocer... 65 1e-08 gb|EME47530.1| hypothetical protein DOTSEDRAFT_69470 [Dothistrom... 63 4e-08 gb|EMC92123.1| hypothetical protein BAUCODRAFT_276951 [Baudoinia... 62 6e-08 gb|EMF14994.1| hypothetical protein SEPMUDRAFT_146995 [Sphaeruli... 62 1e-07 ref|XP_003855037.1| hypothetical protein MYCGRDRAFT_108163 [Zymo... 58 1e-06 >gb|EME85838.1| hypothetical protein MYCFIDRAFT_150893 [Pseudocercospora fijiensis CIRAD86] Length = 528 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 220 ERYRGLIETLLRHPAFTPFINDISKDPSVL 131 ERYRGLIETLLRHPAFTPFINDISKDPSVL Sbjct: 339 ERYRGLIETLLRHPAFTPFINDISKDPSVL 368 >gb|EME47530.1| hypothetical protein DOTSEDRAFT_69470 [Dothistroma septosporum NZE10] Length = 544 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 220 ERYRGLIETLLRHPAFTPFINDISKDPSVL 131 ERYRGLIETLLRHPAFTPFINDIS+DPSVL Sbjct: 348 ERYRGLIETLLRHPAFTPFINDISQDPSVL 377 >gb|EMC92123.1| hypothetical protein BAUCODRAFT_276951 [Baudoinia compniacensis UAMH 10762] Length = 406 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 220 ERYRGLIETLLRHPAFTPFINDISKDPSVLG 128 +RYRGLIETLLRHPAF PFIND+SKDPSVLG Sbjct: 343 DRYRGLIETLLRHPAFHPFINDLSKDPSVLG 373 >gb|EMF14994.1| hypothetical protein SEPMUDRAFT_146995 [Sphaerulina musiva SO2202] Length = 512 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 220 ERYRGLIETLLRHPAFTPFINDISKDPSVL 131 ERYRGLIETLLRHPAFTPFINDIS+DPS L Sbjct: 326 ERYRGLIETLLRHPAFTPFINDISQDPSAL 355 >ref|XP_003855037.1| hypothetical protein MYCGRDRAFT_108163 [Zymoseptoria tritici IPO323] gi|339474921|gb|EGP90013.1| hypothetical protein MYCGRDRAFT_108163 [Zymoseptoria tritici IPO323] Length = 525 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 220 ERYRGLIETLLRHPAFTPFINDISKDPSVL 131 ERYR LIETLLRHP+FTPFINDISKDPS L Sbjct: 336 ERYRTLIETLLRHPSFTPFINDISKDPSSL 365