BLASTX nr result
ID: Akebia25_contig00049561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00049561 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON62297.1| hypothetical protein W97_01518 [Coniosporium apol... 64 2e-08 >gb|EON62297.1| hypothetical protein W97_01518 [Coniosporium apollinis CBS 100218] Length = 235 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = -3 Query: 269 NPVWLPLWPQYFDTTGTRVLIGTASAITFLNIVYLAVSFVPKFSSKYQP 123 NP WLPLWP +F+ GT LIGT+++I LN+ YL +SFVP+F ++P Sbjct: 46 NPWWLPLWPAHFNVHGTTALIGTSASILMLNLFYLTLSFVPRFELAHRP 94