BLASTX nr result
ID: Akebia25_contig00049426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00049426 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EQB55874.1| hypothetical protein CGLO_04154 [Colletotrichum g... 64 3e-08 gb|EFQ25087.1| hypothetical protein GLRG_00231 [Colletotrichum g... 63 5e-08 emb|CCF42443.1| hypothetical protein CH063_12442 [Colletotrichum... 62 8e-08 ref|XP_007279159.1| duf647 domain-containing protein [Colletotri... 61 1e-07 ref|XP_007593941.1| hypothetical protein CFIO01_01821 [Colletotr... 60 3e-07 >gb|EQB55874.1| hypothetical protein CGLO_04154 [Colletotrichum gloeosporioides Cg-14] Length = 500 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/60 (50%), Positives = 41/60 (68%) Frame = -3 Query: 315 STLTHLFRKQEYTLWCESAAPAWYQDSSARTKVLVVLKEGVKARGMLRAWYHALLLSRYL 136 S L LF Q+Y +WC+ + A Y D+++R KVLVVLK GV A+ L+AW+H LLL+ L Sbjct: 372 SNLVELFENQQYIMWCQISEAANY-DAASRIKVLVVLKNGVSAKSQLKAWFHGLLLAERL 430 >gb|EFQ25087.1| hypothetical protein GLRG_00231 [Colletotrichum graminicola M1.001] Length = 484 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/60 (46%), Positives = 44/60 (73%) Frame = -3 Query: 315 STLTHLFRKQEYTLWCESAAPAWYQDSSARTKVLVVLKEGVKARGMLRAWYHALLLSRYL 136 + L +++ ++EY LWCE A+ Y D+++R KV+VVLK+GV + L+AW+H LLL+R L Sbjct: 360 ANLLNIYDEEEYVLWCE-ASETVYCDAASRVKVMVVLKDGVTPKSQLKAWFHGLLLTRRL 418 >emb|CCF42443.1| hypothetical protein CH063_12442 [Colletotrichum higginsianum] Length = 484 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/60 (48%), Positives = 41/60 (68%) Frame = -3 Query: 315 STLTHLFRKQEYTLWCESAAPAWYQDSSARTKVLVVLKEGVKARGMLRAWYHALLLSRYL 136 STL F K+EY LWC + Y D+++R +V+VVLK+GV + L+AW+H LLL+R L Sbjct: 347 STLLRRFEKEEYVLWCVVSERTSY-DAASRVRVMVVLKDGVSPKSQLKAWFHGLLLARRL 405 >ref|XP_007279159.1| duf647 domain-containing protein [Colletotrichum gloeosporioides Nara gc5] gi|429856893|gb|ELA31783.1| duf647 domain-containing protein [Colletotrichum gloeosporioides Nara gc5] Length = 500 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/60 (46%), Positives = 40/60 (66%) Frame = -3 Query: 315 STLTHLFRKQEYTLWCESAAPAWYQDSSARTKVLVVLKEGVKARGMLRAWYHALLLSRYL 136 S L LF Q+Y +WC+ + Y D+++R KVL+VLK GV A+ L+AW+H LLL+ L Sbjct: 372 SNLMELFENQQYIMWCQISEATNY-DAASRIKVLIVLKNGVSAKSQLKAWFHGLLLAERL 430 >ref|XP_007593941.1| hypothetical protein CFIO01_01821 [Colletotrichum fioriniae PJ7] gi|588901975|gb|EXF82361.1| hypothetical protein CFIO01_01821 [Colletotrichum fioriniae PJ7] Length = 473 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/59 (45%), Positives = 40/59 (67%) Frame = -3 Query: 312 TLTHLFRKQEYTLWCESAAPAWYQDSSARTKVLVVLKEGVKARGMLRAWYHALLLSRYL 136 TL +F ++EY LWC+ + A D++++ KV+ VLKEGV R +AW+H LLL+R L Sbjct: 347 TLMEVFDREEYVLWCQVSTAA--DDAASKIKVITVLKEGVTPRSQFKAWFHGLLLARRL 403