BLASTX nr result
ID: Akebia25_contig00049210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00049210 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESZ94577.1| hypothetical protein SBOR_5067 [Sclerotinia borea... 56 6e-06 gb|EME87667.1| hypothetical protein MYCFIDRAFT_209576 [Pseudocer... 56 6e-06 gb|EMF18010.1| hypothetical protein SEPMUDRAFT_32452 [Sphaerulin... 55 8e-06 >gb|ESZ94577.1| hypothetical protein SBOR_5067 [Sclerotinia borealis F-4157] Length = 350 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/49 (55%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = +3 Query: 3 SPRLVPLGSPGPVTPFELEEDDNYLAAGHRSLG--NGNGAHPDELSTRL 143 SPRL+PLGSPGP+TPFELEE YL AG R G G G +E ++ Sbjct: 283 SPRLLPLGSPGPITPFELEETSGYLIAGQRRSGGLTGGGLRENEAIAKI 331 >gb|EME87667.1| hypothetical protein MYCFIDRAFT_209576 [Pseudocercospora fijiensis CIRAD86] Length = 177 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/50 (56%), Positives = 33/50 (66%) Frame = +3 Query: 3 SPRLVPLGSPGPVTPFELEEDDNYLAAGHRSLGNGNGAHPDELSTRLAQA 152 SPRLVPLGSPGPVTP ELE + Y+ AG RS N +EL +L +A Sbjct: 116 SPRLVPLGSPGPVTPLELERGEGYIIAGARSNRASNDTPNEELVEKLIRA 165 >gb|EMF18010.1| hypothetical protein SEPMUDRAFT_32452 [Sphaerulina musiva SO2202] Length = 235 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/51 (58%), Positives = 31/51 (60%) Frame = +3 Query: 3 SPRLVPLGSPGPVTPFELEEDDNYLAAGHRSLGNGNGAHPDELSTRLAQAA 155 SPRL PLGSPGPVTP ELE D+ YL AG R N H ST A AA Sbjct: 163 SPRLAPLGSPGPVTPLELERDEGYLVAGAR-----NVTHSTTTSTATAAAA 208