BLASTX nr result
ID: Akebia25_contig00048568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00048568 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESZ96890.1| hypothetical protein SBOR_2755 [Sclerotinia borea... 60 2e-07 gb|EME48646.1| hypothetical protein DOTSEDRAFT_100831, partial [... 60 3e-07 gb|EMC96507.1| hypothetical protein BAUCODRAFT_33864 [Baudoinia ... 58 1e-06 ref|XP_001588846.1| hypothetical protein SS1G_10394 [Sclerotinia... 58 1e-06 ref|XP_001549504.1| hypothetical protein BC1G_12045 [Botryotinia... 56 5e-06 >gb|ESZ96890.1| hypothetical protein SBOR_2755 [Sclerotinia borealis F-4157] Length = 222 Score = 60.5 bits (145), Expect = 2e-07 Identities = 37/85 (43%), Positives = 50/85 (58%), Gaps = 5/85 (5%) Frame = -2 Query: 242 TVVDTTTYTAPNRFRRDLAE---TDINQEFCDHRKDE*VSQEEIKAMASDLRSDDGSI-- 78 T TTT + P + E T + + ++E +E++ D RSDDGS+ Sbjct: 35 TTTTTTTISKPASKPEPVKEKSPTPVIPPTVEEEEEEEEEEEDV-----DERSDDGSVGP 89 Query: 77 PDFGDSIDASTFEQILEMDDDEEER 3 PD GD+IDA+TFEQILEMDDDE+ER Sbjct: 90 PDLGDNIDAATFEQILEMDDDEDER 114 >gb|EME48646.1| hypothetical protein DOTSEDRAFT_100831, partial [Dothistroma septosporum NZE10] Length = 148 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 110 ASDLRSDDGSIPDFGDSIDASTFEQILEMDDDEEER 3 + D++SDDGS+P+FG+ +D +TFEQILEMDDDEEER Sbjct: 1 SDDVQSDDGSLPEFGEHLDQTTFEQILEMDDDEEER 36 >gb|EMC96507.1| hypothetical protein BAUCODRAFT_33864 [Baudoinia compniacensis UAMH 10762] Length = 155 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 2/36 (5%) Frame = -2 Query: 104 DLRSDDGS--IPDFGDSIDASTFEQILEMDDDEEER 3 D+RS+DGS P+FGDSID +TFEQILEMDDDEEER Sbjct: 9 DVRSEDGSAGFPEFGDSIDQTTFEQILEMDDDEEER 44 >ref|XP_001588846.1| hypothetical protein SS1G_10394 [Sclerotinia sclerotiorum 1980] gi|154694782|gb|EDN94520.1| hypothetical protein SS1G_10394 [Sclerotinia sclerotiorum 1980 UF-70] Length = 187 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 2/36 (5%) Frame = -2 Query: 104 DLRSDDGSI--PDFGDSIDASTFEQILEMDDDEEER 3 D RSDDGS+ PD GD+IDA+TFEQILEMDDDE+ER Sbjct: 44 DERSDDGSVGPPDLGDNIDAATFEQILEMDDDEDER 79 >ref|XP_001549504.1| hypothetical protein BC1G_12045 [Botryotinia fuckeliana B05.10] gi|347833188|emb|CCD48885.1| similar to His-phosphotransfer (HPt) [Botryotinia fuckeliana T4] gi|472244575|gb|EMR89187.1| putative phosphotransmitter protein ypd1 protein [Botryotinia fuckeliana BcDW1] Length = 190 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 2/45 (4%) Frame = -2 Query: 131 QEEIKAMASDLRSDDGSI--PDFGDSIDASTFEQILEMDDDEEER 3 +EE++ D RSDDGS+ PD G++ID++TFEQILEMDDDE+ER Sbjct: 39 KEEVEEQ-DDERSDDGSVGLPDLGENIDSATFEQILEMDDDEDER 82