BLASTX nr result
ID: Akebia25_contig00048427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00048427 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007220255.1| hypothetical protein PRUPE_ppa001444mg [Prun... 67 3e-09 ref|XP_007148792.1| hypothetical protein PHAVU_005G014700g [Phas... 62 6e-08 gb|EXB44298.1| hypothetical protein L484_012217 [Morus notabilis] 62 1e-07 ref|XP_002303960.2| hypothetical protein POPTR_0003s19010g [Popu... 60 2e-07 ref|XP_004233812.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_004168907.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_004147126.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_004499782.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_003526349.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_006347159.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|NP_172596.1| pentatricopeptide repeat-containing protein [Ar... 57 2e-06 ref|XP_006432351.1| hypothetical protein CICLE_v10000307mg [Citr... 56 5e-06 ref|XP_007010747.1| Pentatricopeptide repeat (PPR) superfamily p... 56 5e-06 ref|XP_006304494.1| hypothetical protein CARUB_v10011264mg [Caps... 56 6e-06 ref|XP_002525566.1| pentatricopeptide repeat-containing protein,... 55 8e-06 >ref|XP_007220255.1| hypothetical protein PRUPE_ppa001444mg [Prunus persica] gi|462416717|gb|EMJ21454.1| hypothetical protein PRUPE_ppa001444mg [Prunus persica] Length = 827 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 5/58 (8%) Frame = +3 Query: 87 IQPPPSTAN-----LNSPSPKSSHMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 I PPP T + +++P ++ H LSQR +IPSHVYTHP+AILLE+C+ IKEL QI+ Sbjct: 18 ITPPPLTPSRARPPISAPQFQAFHTLSQRTHIPSHVYTHPAAILLELCTSIKELNQII 75 >ref|XP_007148792.1| hypothetical protein PHAVU_005G014700g [Phaseolus vulgaris] gi|561022056|gb|ESW20786.1| hypothetical protein PHAVU_005G014700g [Phaseolus vulgaris] Length = 814 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = +3 Query: 93 PPPSTANLNSPSPKSSHMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 P P+ N N+ +S L QRI+IPSHVY HPSA+LLE+C+ +KEL QIL Sbjct: 12 PIPNITNQNTKKRPTSVPLYQRIFIPSHVYRHPSAVLLELCTSLKELHQIL 62 >gb|EXB44298.1| hypothetical protein L484_012217 [Morus notabilis] Length = 814 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = +3 Query: 96 PPSTANLNSPSPKSSHMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 PP+ L++ P + H LSQR +IPSHVY HP+AILLE+ + ++ELRQIL Sbjct: 13 PPTKLRLSTSLPGTFHTLSQRTHIPSHVYKHPAAILLELSTSLQELRQIL 62 >ref|XP_002303960.2| hypothetical protein POPTR_0003s19010g [Populus trichocarpa] gi|550343509|gb|EEE78939.2| hypothetical protein POPTR_0003s19010g [Populus trichocarpa] Length = 812 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = +3 Query: 93 PPPSTANLNSPSPKSSHMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 PPP + SP + H LSQR +IPSH+Y HP+AILLE+C+ KE+ QIL Sbjct: 12 PPPQIPS--KASPLAQHTLSQRTHIPSHIYKHPAAILLELCTSSKEVHQIL 60 >ref|XP_004233812.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Solanum lycopersicum] Length = 811 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = +3 Query: 93 PPPSTANLNSPSPKSSHMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 PPP A PS LSQR++IPSH+Y HP+AILLE+C+ +KEL QIL Sbjct: 14 PPPPAAIPQPPS------LSQRVHIPSHIYKHPTAILLELCNSMKELHQIL 58 >ref|XP_004168907.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 821 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/53 (50%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = +3 Query: 90 QPPPSTANLNSPS-PKSSHMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 Q P ++++ PS P H LS+R +IPSHVY HP+A+LLE+C+ +KEL QI+ Sbjct: 17 QTPLKSSSITIPSSPLPFHTLSERAHIPSHVYKHPAAVLLELCTSMKELHQII 69 >ref|XP_004147126.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 821 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/53 (50%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = +3 Query: 90 QPPPSTANLNSPS-PKSSHMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 Q P ++++ PS P H LS+R +IPSHVY HP+A+LLE+C+ +KEL QI+ Sbjct: 17 QTPLKSSSITIPSSPLPFHTLSERAHIPSHVYKHPAAVLLELCTSMKELHQII 69 >ref|XP_004499782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cicer arietinum] Length = 814 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +3 Query: 93 PPPSTANLNSPSPKSSHMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 PP S ++ PK++ QRI+IP+HVY HPSAILLE+C+ +KEL QIL Sbjct: 12 PPLSNNTISKTKPKTTPSY-QRIFIPTHVYRHPSAILLELCTSMKELHQIL 61 >ref|XP_003526349.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Glycine max] Length = 816 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = +3 Query: 93 PPPSTANLNSPSPKSSHMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 P + NL ++ L QRI+IPSHVY HPSAILLE+C+ +KEL QIL Sbjct: 14 PNNTNPNLKKLKTTTTTPLYQRIFIPSHVYRHPSAILLELCTSLKELHQIL 64 >ref|XP_006347159.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Solanum tuberosum] Length = 809 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 4/53 (7%) Frame = +3 Query: 99 PSTANLNSPSPKSS----HMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 P A +PSP ++ LSQR++IPSH+Y HP+AILLE+C+ +KEL QIL Sbjct: 4 PLLARSITPSPPAAIPQPPFLSQRVHIPSHIYKHPTAILLELCNSMKELHQIL 56 >ref|NP_172596.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122213654|sp|Q3E6Q1.1|PPR32_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g11290 gi|332190592|gb|AEE28713.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 809 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +3 Query: 120 SPSPKSSHMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 +P + H LS+R YIP++VY HP+A+LLE CS +KELRQIL Sbjct: 16 NPPSRHRHFLSERNYIPANVYEHPAALLLERCSSLKELRQIL 57 >ref|XP_006432351.1| hypothetical protein CICLE_v10000307mg [Citrus clementina] gi|568883789|ref|XP_006494628.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X1 [Citrus sinensis] gi|568883791|ref|XP_006494629.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X2 [Citrus sinensis] gi|568883793|ref|XP_006494630.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X3 [Citrus sinensis] gi|568883795|ref|XP_006494631.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X4 [Citrus sinensis] gi|557534473|gb|ESR45591.1| hypothetical protein CICLE_v10000307mg [Citrus clementina] Length = 812 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 141 HMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 H LSQR YIPS +Y HPSA+LLE+C+ +KELR+IL Sbjct: 26 HTLSQRAYIPSRIYRHPSALLLEVCTSLKELRRIL 60 >ref|XP_007010747.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508727660|gb|EOY19557.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 886 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = +3 Query: 93 PPPSTANLNSPSPKS-SHMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 PPP T P+PK SH LSQR IP HVY HP+AILLE+ + IKE+ QIL Sbjct: 87 PPPFTI----PTPKPHSHTLSQRTQIPLHVYKHPTAILLELSTSIKEVYQIL 134 >ref|XP_006304494.1| hypothetical protein CARUB_v10011264mg [Capsella rubella] gi|482573205|gb|EOA37392.1| hypothetical protein CARUB_v10011264mg [Capsella rubella] Length = 811 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = +3 Query: 126 SPKSSH---MLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 SP SSH LSQR YIP++VY HP+A+LLE CS +K+LR IL Sbjct: 17 SPNSSHHRHFLSQRTYIPANVYEHPAALLLERCSSLKDLRHIL 59 >ref|XP_002525566.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535145|gb|EEF36825.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 563 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/53 (47%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +3 Query: 93 PPPSTANLNSPSPKSS--HMLSQRIYIPSHVYTHPSAILLEMCSDIKELRQIL 245 P PS + L+S + S+ + L +R YIP H+Y HP+A+LLE+C+ +KEL QI+ Sbjct: 12 PSPSPSPLHSKTRHSTTINTLPRRTYIPGHIYKHPTAVLLELCTSVKELHQII 64