BLASTX nr result
ID: Akebia25_contig00048357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00048357 (249 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003844509.1| similar to mitochondrial import inner membra... 57 3e-06 ref|XP_001799316.1| hypothetical protein SNOG_09013 [Phaeosphaer... 56 6e-06 >ref|XP_003844509.1| similar to mitochondrial import inner membrane translocase subunit Tim8 A [Leptosphaeria maculans JN3] gi|312221089|emb|CBY01030.1| similar to mitochondrial import inner membrane translocase subunit Tim8 A [Leptosphaeria maculans JN3] Length = 90 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -3 Query: 130 KLNPSDAQELQKFQEQEGQKALVQNVIHKLTDVCFKRCILAG 5 +L+ SD QELQ+F EGQK+ +QN IH LTD CF++CI AG Sbjct: 11 RLSESDKQELQQFAASEGQKSRIQNSIHGLTDTCFRKCIPAG 52 >ref|XP_001799316.1| hypothetical protein SNOG_09013 [Phaeosphaeria nodorum SN15] gi|111062085|gb|EAT83205.1| hypothetical protein SNOG_09013 [Phaeosphaeria nodorum SN15] Length = 94 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -3 Query: 130 KLNPSDAQELQKFQEQEGQKALVQNVIHKLTDVCFKRCILAGS 2 KL+ D QELQ+F EGQKA +Q+ IH LTD CF++CI AG+ Sbjct: 15 KLSDRDKQELQQFAMNEGQKARIQSSIHSLTDTCFRKCIPAGN 57