BLASTX nr result
ID: Akebia25_contig00048225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00048225 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513279.1| Protein regulator of cytokinesis, putative [... 56 6e-06 >ref|XP_002513279.1| Protein regulator of cytokinesis, putative [Ricinus communis] gi|223547653|gb|EEF49147.1| Protein regulator of cytokinesis, putative [Ricinus communis] Length = 724 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -1 Query: 324 QTAATPAPPVSVLFGATSKVEEEMRPEEIEYSFEERRAGFVLP 196 QTA TPA PV V +G + EE PEE+EYSFEERRAGFVLP Sbjct: 675 QTAITPAHPVPVPYGGATPKEEV--PEEVEYSFEERRAGFVLP 715