BLASTX nr result
ID: Akebia25_contig00048173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00048173 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280974.1| PREDICTED: pentatricopeptide repeat-containi... 97 3e-18 emb|CAN83162.1| hypothetical protein VITISV_022557 [Vitis vinifera] 97 3e-18 ref|XP_004300372.1| PREDICTED: pentatricopeptide repeat-containi... 96 7e-18 ref|XP_006366292.1| PREDICTED: pentatricopeptide repeat-containi... 92 1e-16 ref|XP_006651297.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_002318784.2| hypothetical protein POPTR_0012s11110g [Popu... 91 2e-16 ref|XP_004241650.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_006586917.1| PREDICTED: pentatricopeptide repeat-containi... 89 6e-16 ref|XP_006485076.1| PREDICTED: pentatricopeptide repeat-containi... 89 6e-16 ref|XP_006436971.1| hypothetical protein CICLE_v10033814mg [Citr... 89 6e-16 dbj|BAJ53121.1| JHL07K02.11 [Jatropha curcas] 89 6e-16 ref|XP_003530188.2| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 ref|XP_006280284.1| hypothetical protein CARUB_v10026208mg [Caps... 87 2e-15 gb|AFJ66232.1| hypothetical protein 34G24.32 [Capsella rubella] 87 2e-15 gb|AFJ66185.1| hypothetical protein 11M19.3 [Arabidopsis halleri] 87 2e-15 ref|XP_007138924.1| hypothetical protein PHAVU_009G249300g [Phas... 87 2e-15 ref|XP_004984658.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_007152938.1| hypothetical protein PHAVU_004G172900g [Phas... 87 3e-15 ref|XP_007038163.1| Tetratricopeptide repeat (TPR)-like superfam... 87 3e-15 ref|XP_007038162.1| Tetratricopeptide repeat-like superfamily pr... 87 3e-15 >ref|XP_002280974.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 [Vitis vinifera] Length = 523 Score = 96.7 bits (239), Expect = 3e-18 Identities = 37/51 (72%), Positives = 48/51 (94%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EIRVSKNLRTC+DCHCWMK++S++L+R+I+VRDR+RFH F+ G CSC+DYW Sbjct: 473 EIRVSKNLRTCHDCHCWMKILSRLLSRVIIVRDRIRFHQFEGGLCSCRDYW 523 >emb|CAN83162.1| hypothetical protein VITISV_022557 [Vitis vinifera] Length = 562 Score = 96.7 bits (239), Expect = 3e-18 Identities = 37/51 (72%), Positives = 48/51 (94%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EIRVSKNLRTC+DCHCWMK++S++L+R+I+VRDR+RFH F+ G CSC+DYW Sbjct: 512 EIRVSKNLRTCHDCHCWMKILSRLLSRVIIVRDRIRFHQFEGGLCSCRDYW 562 >ref|XP_004300372.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990-like [Fragaria vesca subsp. vesca] Length = 555 Score = 95.5 bits (236), Expect = 7e-18 Identities = 36/51 (70%), Positives = 46/51 (90%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EIR+SKNLR C+DCHCW+K+VS++LNR+I+VRDR+RFHHF+ G C C DYW Sbjct: 505 EIRISKNLRICHDCHCWIKLVSRLLNRVIIVRDRIRFHHFEGGMCLCGDYW 555 >ref|XP_006366292.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990-like [Solanum tuberosum] Length = 556 Score = 91.7 bits (226), Expect = 1e-16 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +3 Query: 6 IRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 I+VSKNLRTC DCH WMKMV+KVLNR I+VRDR+RFHHF G CSC DYW Sbjct: 507 IQVSKNLRTCPDCHSWMKMVAKVLNREIIVRDRIRFHHFADGYCSCGDYW 556 >ref|XP_006651297.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990-like [Oryza brachyantha] Length = 555 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EI VSKNL+TC DCH WMK+VSKVL+R+I++RDRVRFH F+ G CSCKDYW Sbjct: 505 EIMVSKNLQTCTDCHEWMKIVSKVLSRVIIMRDRVRFHRFEGGCCSCKDYW 555 >ref|XP_002318784.2| hypothetical protein POPTR_0012s11110g [Populus trichocarpa] gi|550326851|gb|EEE97004.2| hypothetical protein POPTR_0012s11110g [Populus trichocarpa] Length = 543 Score = 90.5 bits (223), Expect = 2e-16 Identities = 34/51 (66%), Positives = 45/51 (88%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 E+R+SKNLR CYDCH W+K+VS++L+R+I+VRDR+RFH F+ G CSC DYW Sbjct: 493 EVRISKNLRICYDCHSWIKIVSRLLSRVIIVRDRIRFHRFENGLCSCGDYW 543 >ref|XP_004241650.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990-like [Solanum lycopersicum] Length = 554 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +3 Query: 6 IRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 I+VSKNLRTC DCH WMKMV+K+LNR I+VRDR+RFHHF G CSC DYW Sbjct: 505 IQVSKNLRTCPDCHSWMKMVAKLLNREIIVRDRIRFHHFADGYCSCGDYW 554 >ref|XP_006586917.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990-like [Glycine max] Length = 542 Score = 89.0 bits (219), Expect = 6e-16 Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 +IR+SKNLR C DCH W+K+VSK+LNR I+VRDR+RFH F+ G CSCKDYW Sbjct: 492 KIRISKNLRICLDCHNWIKIVSKILNRKIIVRDRIRFHQFEGGVCSCKDYW 542 >ref|XP_006485076.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990-like [Citrus sinensis] Length = 537 Score = 89.0 bits (219), Expect = 6e-16 Identities = 34/51 (66%), Positives = 44/51 (86%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EIR+SKNLR C+DCH W+KM+S++L R+I+VRDR+RFH F+ G CSC DYW Sbjct: 487 EIRISKNLRICHDCHSWIKMISRLLRRVIIVRDRIRFHRFEGGLCSCGDYW 537 >ref|XP_006436971.1| hypothetical protein CICLE_v10033814mg [Citrus clementina] gi|557539167|gb|ESR50211.1| hypothetical protein CICLE_v10033814mg [Citrus clementina] Length = 540 Score = 89.0 bits (219), Expect = 6e-16 Identities = 34/51 (66%), Positives = 44/51 (86%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EIR+SKNLR C+DCH W+KM+S++L R+I+VRDR+RFH F+ G CSC DYW Sbjct: 490 EIRISKNLRICHDCHSWIKMISRLLRRVIIVRDRIRFHRFEGGLCSCGDYW 540 >dbj|BAJ53121.1| JHL07K02.11 [Jatropha curcas] Length = 514 Score = 89.0 bits (219), Expect = 6e-16 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EIR+ KNLR CYDCH W+KMVS +L+R+I++RDR+RFH F+ GSCSC DYW Sbjct: 464 EIRIYKNLRICYDCHNWIKMVSGLLSRVIIIRDRIRFHRFEGGSCSCGDYW 514 >ref|XP_003530188.2| PREDICTED: pentatricopeptide repeat-containing protein At3g14330-like [Glycine max] Length = 706 Score = 88.2 bits (217), Expect = 1e-15 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = +3 Query: 6 IRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 IR++KNLR C DCH WMK VSKV R+IV+RD RFHHF+ GSCSCKDYW Sbjct: 657 IRITKNLRVCVDCHSWMKAVSKVTRRLIVLRDTNRFHHFENGSCSCKDYW 706 >ref|XP_006280284.1| hypothetical protein CARUB_v10026208mg [Capsella rubella] gi|482548988|gb|EOA13182.1| hypothetical protein CARUB_v10026208mg [Capsella rubella] Length = 534 Score = 87.4 bits (215), Expect = 2e-15 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EIR+ KN+R C DCH W+K VSK+LNR+I++RDR+RFH F+ G CSCKDYW Sbjct: 484 EIRIQKNIRMCSDCHNWIKAVSKLLNRVIIMRDRIRFHRFEDGLCSCKDYW 534 >gb|AFJ66232.1| hypothetical protein 34G24.32 [Capsella rubella] Length = 598 Score = 87.4 bits (215), Expect = 2e-15 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EIR+ KN+R C DCH W+K VSK+LNR+I++RDR+RFH F+ G CSCKDYW Sbjct: 548 EIRIQKNIRMCSDCHNWIKAVSKLLNRVIIMRDRIRFHRFEDGLCSCKDYW 598 >gb|AFJ66185.1| hypothetical protein 11M19.3 [Arabidopsis halleri] Length = 511 Score = 87.4 bits (215), Expect = 2e-15 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EIR+ KN+R C DCH W+K VSK+LNR+I++RDR+RFH F+ G CSCKDYW Sbjct: 461 EIRIQKNIRMCSDCHNWIKAVSKLLNRVIIMRDRIRFHRFEDGLCSCKDYW 511 >ref|XP_007138924.1| hypothetical protein PHAVU_009G249300g [Phaseolus vulgaris] gi|561012011|gb|ESW10918.1| hypothetical protein PHAVU_009G249300g [Phaseolus vulgaris] Length = 543 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 +IR+SKNLR C DCH W+K VSK+LNR I+VRDR+RFH F+ G CSC+DYW Sbjct: 493 KIRISKNLRICLDCHNWIKTVSKILNREIIVRDRIRFHQFEGGVCSCRDYW 543 >ref|XP_004984658.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990-like isoform X1 [Setaria italica] Length = 555 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EI VSKNL+TC DCH W+K++SKVL R+I++RDR+RFH F+ G CSCKDYW Sbjct: 505 EIMVSKNLQTCSDCHEWIKIISKVLCRVIIMRDRIRFHRFESGRCSCKDYW 555 >ref|XP_007152938.1| hypothetical protein PHAVU_004G172900g [Phaseolus vulgaris] gi|561026247|gb|ESW24932.1| hypothetical protein PHAVU_004G172900g [Phaseolus vulgaris] Length = 648 Score = 86.7 bits (213), Expect = 3e-15 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = +3 Query: 6 IRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 IR++KNLR C DCH WMK VS+V R+IVVRD RFHHF+ G+CSCKDYW Sbjct: 599 IRITKNLRVCVDCHSWMKAVSEVTRRLIVVRDTNRFHHFENGTCSCKDYW 648 >ref|XP_007038163.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 2 [Theobroma cacao] gi|508775408|gb|EOY22664.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 2 [Theobroma cacao] Length = 542 Score = 86.7 bits (213), Expect = 3e-15 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EI +SKNLR C+DCH W+KMVSK+L R+I+VRDR+RFH F+ G CSC DYW Sbjct: 492 EIMISKNLRICHDCHNWIKMVSKLLIRVIIVRDRIRFHRFEGGLCSCADYW 542 >ref|XP_007038162.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508775407|gb|EOY22663.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 568 Score = 86.7 bits (213), Expect = 3e-15 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +3 Query: 3 EIRVSKNLRTCYDCHCWMKMVSKVLNRIIVVRDRVRFHHFKRGSCSCKDYW 155 EI +SKNLR C+DCH W+KMVSK+L R+I+VRDR+RFH F+ G CSC DYW Sbjct: 492 EIMISKNLRICHDCHNWIKMVSKLLIRVIIVRDRIRFHRFEGGLCSCADYW 542