BLASTX nr result
ID: Akebia25_contig00048127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00048127 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON61129.1| large subunit ribosomal protein L6e [Coniosporium... 106 4e-21 gb|EPE31540.1| hypothetical protein GLAREA_12296 [Glarea lozoyen... 99 6e-19 gb|EHL02401.1| putative 60S ribosomal protein L6-B [Glarea lozoy... 99 6e-19 gb|ELR08477.1| large subunit ribosomal protein L6e [Pseudogymnoa... 96 5e-18 emb|CCU81952.1| 60S ribosomal protein L6 [Blumeria graminis f. s... 94 2e-17 gb|EPQ63564.1| Protein component of the large (60S) ribosomal su... 94 2e-17 ref|XP_001243067.1| 60S ribosomal protein L6 [Coccidioides immit... 94 3e-17 gb|EME87609.1| hypothetical protein MYCFIDRAFT_47959 [Pseudocerc... 92 6e-17 ref|XP_003174356.1| 60S ribosomal protein L6 [Arthroderma gypseu... 92 1e-16 ref|XP_007579893.1| putative 60s ribosomal protein l6 protein [N... 91 2e-16 ref|XP_003857135.1| 60S ribosomal protein L6 [Zymoseptoria triti... 91 2e-16 gb|EKG16680.1| Ribosomal protein L6E [Macrophomina phaseolina MS6] 90 3e-16 gb|EGD98272.1| 60S ribosomal protein L6 [Trichophyton tonsurans ... 89 5e-16 ref|XP_003231643.1| 60S ribosomal protein L6 [Trichophyton rubru... 89 5e-16 gb|EFW16556.1| 60S ribosomal protein L6 [Coccidioides posadasii ... 89 5e-16 ref|XP_002585209.1| 60S ribosomal protein L6-B [Uncinocarpus ree... 89 6e-16 gb|EPS25695.1| hypothetical protein PDE_00629 [Penicillium oxali... 89 8e-16 gb|EEH08314.1| 60S ribosomal protein L6 [Ajellomyces capsulatus ... 89 8e-16 ref|XP_001544746.1| 60S ribosomal protein L6 [Ajellomyces capsul... 89 8e-16 ref|XP_003023970.1| hypothetical protein TRV_01912 [Trichophyton... 88 1e-15 >gb|EON61129.1| large subunit ribosomal protein L6e [Coniosporium apollinis CBS 100218] Length = 182 Score = 106 bits (264), Expect = 4e-21 Identities = 51/58 (87%), Positives = 56/58 (96%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEMVF 176 FKQGEKPE+KKV+S+RAEDQ+SVDKALL+ LKKEPFLLSYL STFSLRKGDRPHEMVF Sbjct: 125 FKQGEKPESKKVSSNRAEDQRSVDKALLANLKKEPFLLSYLGSTFSLRKGDRPHEMVF 182 >gb|EPE31540.1| hypothetical protein GLAREA_12296 [Glarea lozoyensis ATCC 20868] Length = 205 Score = 99.0 bits (245), Expect = 6e-19 Identities = 47/58 (81%), Positives = 54/58 (93%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEMVF 176 FKQGEKPE KK +S RA DQK+VDKALL+T+KKEPFL+SYL+STFSLRKGDRPHEMV+ Sbjct: 148 FKQGEKPEKKKPSSSRAADQKAVDKALLATIKKEPFLISYLSSTFSLRKGDRPHEMVW 205 >gb|EHL02401.1| putative 60S ribosomal protein L6-B [Glarea lozoyensis 74030] Length = 205 Score = 99.0 bits (245), Expect = 6e-19 Identities = 47/58 (81%), Positives = 54/58 (93%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEMVF 176 FKQGEKPE KK +S RA DQK+VDKALL+T+KKEPFL+SYL+STFSLRKGDRPHEMV+ Sbjct: 148 FKQGEKPEKKKPSSSRAADQKAVDKALLATIKKEPFLISYLSSTFSLRKGDRPHEMVW 205 >gb|ELR08477.1| large subunit ribosomal protein L6e [Pseudogymnoascus destructans 20631-21] Length = 202 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEMVF 176 FKQGEKPE KK +S+RA DQKSVDK++LS +KKEPFL+SYLAS+FSLRKGDRPHEM + Sbjct: 145 FKQGEKPEKKKPSSNRAADQKSVDKSILSAIKKEPFLVSYLASSFSLRKGDRPHEMAW 202 >emb|CCU81952.1| 60S ribosomal protein L6 [Blumeria graminis f. sp. hordei DH14] Length = 207 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEMVF 176 FKQGEKPE KK +S RA DQK+VDK LL+T+KKEPFL+ YL STFSLRKGDRPHEM + Sbjct: 150 FKQGEKPEKKKPSSSRAADQKAVDKTLLATIKKEPFLIGYLGSTFSLRKGDRPHEMAW 207 >gb|EPQ63564.1| Protein component of the large (60S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] Length = 207 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEMVF 176 FKQGEKPE KK +S RA DQK+VDK LL+T+KKEPFL+ YL STFSLRKGDRPHEM + Sbjct: 150 FKQGEKPEKKKPSSSRAADQKAVDKTLLATIKKEPFLIGYLGSTFSLRKGDRPHEMAW 207 >ref|XP_001243067.1| 60S ribosomal protein L6 [Coccidioides immitis RS] gi|303320287|ref|XP_003070143.1| 60S ribosomal protein L6 [Coccidioides posadasii C735 delta SOWgp] gi|240109829|gb|EER27998.1| 60S ribosomal protein L6-B, putative [Coccidioides posadasii C735 delta SOWgp] gi|392865954|gb|EJB11039.1| 60S ribosomal protein L6 [Coccidioides immitis RS] Length = 206 Score = 93.6 bits (231), Expect = 3e-17 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEM 170 FKQGEKPE KKVAS RA DQK++D+ALL+T+KKEPFL SYLASTFSLR GD+PHEM Sbjct: 149 FKQGEKPEKKKVASARAADQKAIDQALLATIKKEPFLGSYLASTFSLRTGDKPHEM 204 >gb|EME87609.1| hypothetical protein MYCFIDRAFT_47959 [Pseudocercospora fijiensis CIRAD86] Length = 191 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/58 (72%), Positives = 52/58 (89%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEMVF 176 F+QGEKP+ K+VA RAEDQK VDKALL+++KKEP LL YL+++FSLRKGDRPH+MVF Sbjct: 134 FQQGEKPQKKEVAGERAEDQKKVDKALLASIKKEPLLLGYLSTSFSLRKGDRPHDMVF 191 >ref|XP_003174356.1| 60S ribosomal protein L6 [Arthroderma gypseum CBS 118893] gi|311342323|gb|EFR01526.1| 60S ribosomal protein L6-B [Arthroderma gypseum CBS 118893] Length = 198 Score = 91.7 bits (226), Expect = 1e-16 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEM 170 FKQGEKPE KK+ S RA DQK+VD ALL+T+KKE FL SYLAS+FSLRKGDRPHEM Sbjct: 141 FKQGEKPEKKKITSERASDQKAVDSALLATIKKEEFLDSYLASSFSLRKGDRPHEM 196 >ref|XP_007579893.1| putative 60s ribosomal protein l6 protein [Neofusicoccum parvum UCRNP2] gi|485929173|gb|EOD52633.1| putative 60s ribosomal protein l6 protein [Neofusicoccum parvum UCRNP2] Length = 202 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/59 (74%), Positives = 52/59 (88%), Gaps = 1/59 (1%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKK-EPFLLSYLASTFSLRKGDRPHEMVF 176 FKQGEKPEA+K AS R EDQ+SVDKA+L+ +KK +P+LLSYL STFSLRKGD+PH MVF Sbjct: 144 FKQGEKPEARKPASTRVEDQRSVDKAILANIKKSDPYLLSYLGSTFSLRKGDKPHAMVF 202 >ref|XP_003857135.1| 60S ribosomal protein L6 [Zymoseptoria tritici IPO323] gi|339477020|gb|EGP92111.1| hypothetical protein MYCGRDRAFT_102740 [Zymoseptoria tritici IPO323] Length = 198 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/58 (74%), Positives = 48/58 (82%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEMVF 176 F+QGEKP K+VA RAEDQK VDKALLS +KKEP L YL++ FSLRKGDRPHEMVF Sbjct: 141 FQQGEKPAKKEVAGERAEDQKKVDKALLSAIKKEPLLQGYLSTNFSLRKGDRPHEMVF 198 >gb|EKG16680.1| Ribosomal protein L6E [Macrophomina phaseolina MS6] Length = 202 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/59 (72%), Positives = 52/59 (88%), Gaps = 1/59 (1%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKK-EPFLLSYLASTFSLRKGDRPHEMVF 176 FKQGEKPEA+K AS R EDQ+SVDKA+L+ +KK +P+L+SYL STFSLRKGD+PH MVF Sbjct: 144 FKQGEKPEARKPASSRVEDQRSVDKAILANIKKSDPYLISYLGSTFSLRKGDKPHAMVF 202 >gb|EGD98272.1| 60S ribosomal protein L6 [Trichophyton tonsurans CBS 112818] gi|326479195|gb|EGE03205.1| 60S ribosomal protein L6 [Trichophyton equinum CBS 127.97] gi|607891651|gb|EZF31271.1| hypothetical protein H101_05108 [Trichophyton interdigitale H6] Length = 198 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEM 170 FKQGE PE KK+ S RA DQK+VD ALL+T+KKE FL SYLAS+FSLRKGDRPHEM Sbjct: 141 FKQGEAPEKKKITSERASDQKAVDSALLATIKKEEFLDSYLASSFSLRKGDRPHEM 196 >ref|XP_003231643.1| 60S ribosomal protein L6 [Trichophyton rubrum CBS 118892] gi|326466271|gb|EGD91724.1| 60S ribosomal protein L6 [Trichophyton rubrum CBS 118892] gi|607882431|gb|EZF27128.1| hypothetical protein H100_00835 [Trichophyton rubrum MR850] gi|607909148|gb|EZF46117.1| hypothetical protein H102_00827 [Trichophyton rubrum CBS 100081] gi|607921285|gb|EZF56837.1| hypothetical protein H103_00835 [Trichophyton rubrum CBS 288.86] gi|607933251|gb|EZF67374.1| hypothetical protein H104_00819 [Trichophyton rubrum CBS 289.86] gi|607945392|gb|EZF78226.1| hypothetical protein H105_00831 [Trichophyton soudanense CBS 452.61] gi|607957318|gb|EZF88698.1| hypothetical protein H110_00835 [Trichophyton rubrum MR1448] gi|607969549|gb|EZF99530.1| hypothetical protein H113_00836 [Trichophyton rubrum MR1459] gi|607981689|gb|EZG10579.1| hypothetical protein H106_00630 [Trichophyton rubrum CBS 735.88] gi|607993521|gb|EZG21033.1| hypothetical protein H107_00885 [Trichophyton rubrum CBS 202.88] Length = 198 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEM 170 FKQGE PE KK+ S RA DQK+VD ALL+T+KKE FL SYLAS+FSLRKGDRPHEM Sbjct: 141 FKQGEAPEKKKITSERASDQKAVDSALLATIKKEEFLDSYLASSFSLRKGDRPHEM 196 >gb|EFW16556.1| 60S ribosomal protein L6 [Coccidioides posadasii str. Silveira] Length = 205 Score = 89.4 bits (220), Expect = 5e-16 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEM 170 FKQGEKPE KKVAS RA DQK++D+ALL+T+KKEPFL SYLASTFSLR GD+PHEM Sbjct: 149 FKQGEKPE-KKVASARAADQKAIDQALLATIKKEPFLGSYLASTFSLRTGDKPHEM 203 >ref|XP_002585209.1| 60S ribosomal protein L6-B [Uncinocarpus reesii 1704] gi|237906655|gb|EEP81056.1| 60S ribosomal protein L6-B [Uncinocarpus reesii 1704] Length = 327 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEM 170 FK G+KPE KKVAS RA DQK++D+ LL+T+KKEPFL SYLASTFSLR GD+PHEM Sbjct: 270 FKNGQKPEKKKVASARAADQKAIDQTLLATIKKEPFLGSYLASTFSLRTGDKPHEM 325 >gb|EPS25695.1| hypothetical protein PDE_00629 [Penicillium oxalicum 114-2] Length = 197 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEM 170 FKQGEKPE KKVAS RA DQK+VD+++LS++KKE FL SYLA+TFSLR GD+PHEM Sbjct: 140 FKQGEKPEKKKVASARAADQKAVDQSILSSIKKEEFLSSYLATTFSLRNGDKPHEM 195 >gb|EEH08314.1| 60S ribosomal protein L6 [Ajellomyces capsulatus G186AR] gi|240276099|gb|EER39611.1| 60S ribosomal protein L6 [Ajellomyces capsulatus H143] gi|325090036|gb|EGC43346.1| 60S ribosomal protein [Ajellomyces capsulatus H88] Length = 204 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/56 (73%), Positives = 50/56 (89%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEM 170 FKQGEKPE KKVA+ RA DQK++D+ LL+T+KKE FL SYL+S+FSLRKGD+PHEM Sbjct: 147 FKQGEKPEKKKVATARANDQKAIDQPLLATIKKEQFLASYLSSSFSLRKGDKPHEM 202 >ref|XP_001544746.1| 60S ribosomal protein L6 [Ajellomyces capsulatus NAm1] gi|150408387|gb|EDN03928.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] Length = 204 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/56 (73%), Positives = 50/56 (89%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEM 170 FKQGEKPE KKVA+ RA DQK++D+ LL+T+KKE FL SYL+S+FSLRKGD+PHEM Sbjct: 147 FKQGEKPEKKKVATARANDQKAIDQPLLATIKKEQFLASYLSSSFSLRKGDKPHEM 202 >ref|XP_003023970.1| hypothetical protein TRV_01912 [Trichophyton verrucosum HKI 0517] gi|291187993|gb|EFE43352.1| hypothetical protein TRV_01912 [Trichophyton verrucosum HKI 0517] Length = 235 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/56 (76%), Positives = 47/56 (83%) Frame = +3 Query: 3 FKQGEKPEAKKVASHRAEDQKSVDKALLSTLKKEPFLLSYLASTFSLRKGDRPHEM 170 FKQGE PE KK S RA DQK+VD ALL+T+KKE FL SYLAS+FSLRKGDRPHEM Sbjct: 178 FKQGEAPEKKKTTSERASDQKAVDSALLATIKKEEFLDSYLASSFSLRKGDRPHEM 233