BLASTX nr result
ID: Akebia25_contig00048012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00048012 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007011635.1| Histidine kinase cytokinin receptor isoform ... 58 1e-06 ref|XP_007011634.1| Histidine kinase cytokinin receptor isoform ... 58 1e-06 ref|XP_006601205.1| PREDICTED: histidine kinase 5-like [Glycine ... 57 3e-06 ref|XP_006582480.1| PREDICTED: histidine kinase 5-like [Glycine ... 57 3e-06 ref|XP_002324940.2| hypothetical protein POPTR_0018s03320g [Popu... 57 3e-06 ref|XP_006483731.1| PREDICTED: histidine kinase 5-like [Citrus s... 56 4e-06 ref|XP_006450209.1| hypothetical protein CICLE_v10010162mg [Citr... 56 4e-06 ref|XP_002309700.2| hypothetical protein POPTR_0006s28530g [Popu... 56 6e-06 ref|XP_006388555.1| hypothetical protein POPTR_0157s00200g, part... 56 6e-06 ref|XP_002271743.2| PREDICTED: histidine kinase 5-like [Vitis vi... 56 6e-06 emb|CBI23998.3| unnamed protein product [Vitis vinifera] 56 6e-06 emb|CAN76109.1| hypothetical protein VITISV_033090 [Vitis vinifera] 56 6e-06 ref|XP_006596059.1| PREDICTED: histidine kinase 5-like [Glycine ... 55 8e-06 gb|EYU29184.1| hypothetical protein MIMGU_mgv1a021155mg [Mimulus... 55 1e-05 >ref|XP_007011635.1| Histidine kinase cytokinin receptor isoform 2 [Theobroma cacao] gi|508781998|gb|EOY29254.1| Histidine kinase cytokinin receptor isoform 2 [Theobroma cacao] Length = 1017 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHI 203 DEC ANGMDSFVSKPVTFQKLKECL+Q++ Sbjct: 988 DECYANGMDSFVSKPVTFQKLKECLEQYL 1016 >ref|XP_007011634.1| Histidine kinase cytokinin receptor isoform 1 [Theobroma cacao] gi|508781997|gb|EOY29253.1| Histidine kinase cytokinin receptor isoform 1 [Theobroma cacao] Length = 953 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHI 203 DEC ANGMDSFVSKPVTFQKLKECL+Q++ Sbjct: 924 DECYANGMDSFVSKPVTFQKLKECLEQYL 952 >ref|XP_006601205.1| PREDICTED: histidine kinase 5-like [Glycine max] Length = 1011 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHI 203 DEC ANGMDSFVSKPVTFQKLK+CL+Q++ Sbjct: 982 DECYANGMDSFVSKPVTFQKLKDCLEQYL 1010 >ref|XP_006582480.1| PREDICTED: histidine kinase 5-like [Glycine max] Length = 763 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHIL 200 +EC ANGMDSFVSKPVTFQKLKEC++Q+++ Sbjct: 731 EECFANGMDSFVSKPVTFQKLKECIEQYLV 760 >ref|XP_002324940.2| hypothetical protein POPTR_0018s03320g [Populus trichocarpa] gi|550317938|gb|EEF03505.2| hypothetical protein POPTR_0018s03320g [Populus trichocarpa] Length = 1012 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHI 203 +EC ANGMDSFVSKPVTFQKLKECL+Q++ Sbjct: 983 EECYANGMDSFVSKPVTFQKLKECLEQYL 1011 >ref|XP_006483731.1| PREDICTED: histidine kinase 5-like [Citrus sinensis] Length = 955 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQH 206 +EC ANGMDSFVSKPVTFQKLKECL+Q+ Sbjct: 926 EECFANGMDSFVSKPVTFQKLKECLEQY 953 >ref|XP_006450209.1| hypothetical protein CICLE_v10010162mg [Citrus clementina] gi|557553435|gb|ESR63449.1| hypothetical protein CICLE_v10010162mg [Citrus clementina] Length = 1002 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQH 206 +EC ANGMDSFVSKPVTFQKLKECL+Q+ Sbjct: 973 EECFANGMDSFVSKPVTFQKLKECLEQY 1000 >ref|XP_002309700.2| hypothetical protein POPTR_0006s28530g [Populus trichocarpa] gi|550337271|gb|EEE93223.2| hypothetical protein POPTR_0006s28530g [Populus trichocarpa] Length = 923 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHI 203 +EC ANGMDSFVSKPVTFQK+KECL+Q++ Sbjct: 894 EECYANGMDSFVSKPVTFQKIKECLEQYL 922 >ref|XP_006388555.1| hypothetical protein POPTR_0157s00200g, partial [Populus trichocarpa] gi|550310388|gb|ERP47469.1| hypothetical protein POPTR_0157s00200g, partial [Populus trichocarpa] Length = 178 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHI 203 +EC ANGMDSFVSKPVTFQK+KECL+Q++ Sbjct: 149 EECYANGMDSFVSKPVTFQKIKECLEQYL 177 >ref|XP_002271743.2| PREDICTED: histidine kinase 5-like [Vitis vinifera] Length = 1012 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHI 203 DEC ANGMDSFVSKPVTFQKL +CLQQ++ Sbjct: 983 DECYANGMDSFVSKPVTFQKLTQCLQQYL 1011 >emb|CBI23998.3| unnamed protein product [Vitis vinifera] Length = 803 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHI 203 DEC ANGMDSFVSKPVTFQKL +CLQQ++ Sbjct: 774 DECYANGMDSFVSKPVTFQKLTQCLQQYL 802 >emb|CAN76109.1| hypothetical protein VITISV_033090 [Vitis vinifera] Length = 979 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHI 203 DEC ANGMDSFVSKPVTFQKL +CLQQ++ Sbjct: 950 DECYANGMDSFVSKPVTFQKLTQCLQQYL 978 >ref|XP_006596059.1| PREDICTED: histidine kinase 5-like [Glycine max] Length = 1012 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHI 203 +EC ANGMDSFVSKPVTFQKLK+CL+Q++ Sbjct: 983 EECYANGMDSFVSKPVTFQKLKDCLEQYL 1011 >gb|EYU29184.1| hypothetical protein MIMGU_mgv1a021155mg [Mimulus guttatus] Length = 908 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -3 Query: 289 DECLANGMDSFVSKPVTFQKLKECLQQHI 203 DEC ANGMDSFVSKPVTFQ L++CLQQ++ Sbjct: 879 DECYANGMDSFVSKPVTFQNLRQCLQQYL 907