BLASTX nr result
ID: Akebia25_contig00047801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00047801 (249 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617766.1| Cytochrome P450 monooxygenase CYP72A59 [Medi... 62 8e-08 ref|XP_004488669.1| PREDICTED: secologanin synthase-like [Cicer ... 60 4e-07 ref|XP_004488695.1| PREDICTED: secologanin synthase-like [Cicer ... 59 9e-07 ref|XP_004295683.1| PREDICTED: secologanin synthase-like [Fragar... 57 2e-06 dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza urale... 57 3e-06 ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus... 57 3e-06 ref|XP_006442294.1| hypothetical protein CICLE_v10024650mg [Citr... 57 3e-06 ref|XP_006442293.1| hypothetical protein CICLE_v10024650mg [Citr... 57 3e-06 ref|XP_004294188.1| PREDICTED: secologanin synthase-like [Fragar... 57 3e-06 gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago ... 57 3e-06 dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula] 57 3e-06 ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus... 56 5e-06 ref|XP_006477947.1| PREDICTED: secologanin synthase-like [Citrus... 56 5e-06 ref|XP_006377685.1| hypothetical protein POPTR_0011s102202g, par... 56 5e-06 ref|XP_006377676.1| hypothetical protein POPTR_0011s10150g [Popu... 56 5e-06 ref|XP_006377672.1| hypothetical protein POPTR_0011s101202g, par... 56 5e-06 ref|XP_006387917.1| hypothetical protein POPTR_0480s00200g [Popu... 56 5e-06 gb|ABC59077.1| cytochrome P450 monooxygenase CYP72A68 [Medicago ... 56 5e-06 gb|AFK38261.1| unknown [Medicago truncatula] 56 5e-06 dbj|BAL45204.1| cytochrome P450 monooxygenase [Medicago truncatula] 56 5e-06 >ref|XP_003617766.1| Cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula] gi|355519101|gb|AET00725.1| Cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula] Length = 516 Score = 62.0 bits (149), Expect = 8e-08 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = -2 Query: 116 MGTIWAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 +G IWAW++L W+WL+P KLE+ LR+QG++G PYR+ Y Sbjct: 14 VGLIWAWRILNWLWLRPKKLEKLLREQGLQGNPYRILY 51 >ref|XP_004488669.1| PREDICTED: secologanin synthase-like [Cicer arietinum] Length = 518 Score = 59.7 bits (143), Expect = 4e-07 Identities = 21/33 (63%), Positives = 30/33 (90%) Frame = -2 Query: 107 IWAWKVLYWIWLKPMKLERELRQQGIRGPPYRL 9 +WAWK+L+W+WL+P KLE+ LR+QG++G PYRL Sbjct: 18 VWAWKMLHWLWLRPKKLEKLLREQGLKGNPYRL 50 >ref|XP_004488695.1| PREDICTED: secologanin synthase-like [Cicer arietinum] Length = 513 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -2 Query: 107 IWAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 +WAWK W+WLKP KLER LR+QG++G YRL Y Sbjct: 18 VWAWKAFNWLWLKPKKLERILREQGLKGTSYRLLY 52 >ref|XP_004295683.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca] Length = 523 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -2 Query: 104 WAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 WAW +L W+W KP KLER LRQQG +G YRLFY Sbjct: 22 WAWSLLDWVWFKPKKLERCLRQQGFQGNAYRLFY 55 >dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis] Length = 522 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/36 (58%), Positives = 29/36 (80%) Frame = -2 Query: 116 MGTIWAWKVLYWIWLKPMKLERELRQQGIRGPPYRL 9 + WAW++L W+WL+P KLER LR+QG++G PYRL Sbjct: 19 LAVTWAWRMLNWLWLRPKKLERLLREQGLQGNPYRL 54 >ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus sinensis] Length = 522 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -2 Query: 104 WAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 WAW+VL W+WL+P KLE+ LRQQG++G YRL + Sbjct: 20 WAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLF 53 >ref|XP_006442294.1| hypothetical protein CICLE_v10024650mg [Citrus clementina] gi|567899614|ref|XP_006442295.1| hypothetical protein CICLE_v10024650mg [Citrus clementina] gi|557544556|gb|ESR55534.1| hypothetical protein CICLE_v10024650mg [Citrus clementina] gi|557544557|gb|ESR55535.1| hypothetical protein CICLE_v10024650mg [Citrus clementina] Length = 266 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -2 Query: 104 WAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 WAW+VL W+WL+P KLE+ LRQQG++G YRL + Sbjct: 20 WAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLF 53 >ref|XP_006442293.1| hypothetical protein CICLE_v10024650mg [Citrus clementina] gi|557544555|gb|ESR55533.1| hypothetical protein CICLE_v10024650mg [Citrus clementina] Length = 167 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -2 Query: 104 WAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 WAW+VL W+WL+P KLE+ LRQQG++G YRL + Sbjct: 20 WAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLF 53 >ref|XP_004294188.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca] Length = 521 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -2 Query: 104 WAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 WAW VL W+WLKP KLER LR+QG++G YR+F+ Sbjct: 22 WAWSVLDWLWLKPKKLERCLREQGLQGNSYRIFH 55 >gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula] Length = 518 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/36 (58%), Positives = 29/36 (80%) Frame = -2 Query: 116 MGTIWAWKVLYWIWLKPMKLERELRQQGIRGPPYRL 9 + IWAW++L W+WLKP KLE+ LR+QG++G YRL Sbjct: 15 LSLIWAWRILNWLWLKPKKLEKLLREQGLKGNSYRL 50 >dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula] Length = 518 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/36 (58%), Positives = 29/36 (80%) Frame = -2 Query: 116 MGTIWAWKVLYWIWLKPMKLERELRQQGIRGPPYRL 9 + IWAW++L W+WLKP KLE+ LR+QG++G YRL Sbjct: 15 LSLIWAWRILNWLWLKPKKLEKLLREQGLKGNSYRL 50 >ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus sinensis] Length = 522 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -2 Query: 104 WAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 WAW+VL W+WL+P KLE+ LRQQG++G YRL + Sbjct: 20 WAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLF 53 >ref|XP_006477947.1| PREDICTED: secologanin synthase-like [Citrus sinensis] Length = 263 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -2 Query: 104 WAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 WAW+VL W+WL+P KLE+ LRQQG++G YRL + Sbjct: 20 WAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLF 53 >ref|XP_006377685.1| hypothetical protein POPTR_0011s102202g, partial [Populus trichocarpa] gi|550328065|gb|ERP55482.1| hypothetical protein POPTR_0011s102202g, partial [Populus trichocarpa] Length = 92 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 104 WAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 WAW+VL W+W +P K+ER LRQQG G PYRL + Sbjct: 20 WAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLF 53 >ref|XP_006377676.1| hypothetical protein POPTR_0011s10150g [Populus trichocarpa] gi|550328056|gb|ERP55473.1| hypothetical protein POPTR_0011s10150g [Populus trichocarpa] Length = 492 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 104 WAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 WAW+VL W+W +P K+ER LRQQG G PYRL + Sbjct: 20 WAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLF 53 >ref|XP_006377672.1| hypothetical protein POPTR_0011s101202g, partial [Populus trichocarpa] gi|550328052|gb|ERP55469.1| hypothetical protein POPTR_0011s101202g, partial [Populus trichocarpa] Length = 396 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 104 WAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 WAW+VL W+W +P K+ER LRQQG G PYRL + Sbjct: 20 WAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLF 53 >ref|XP_006387917.1| hypothetical protein POPTR_0480s00200g [Populus trichocarpa] gi|550308854|gb|ERP46831.1| hypothetical protein POPTR_0480s00200g [Populus trichocarpa] Length = 97 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 104 WAWKVLYWIWLKPMKLERELRQQGIRGPPYRLFY 3 WAW+VL W+W +P K+ER LRQQG G PYRL + Sbjct: 20 WAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLF 53 >gb|ABC59077.1| cytochrome P450 monooxygenase CYP72A68 [Medicago truncatula] Length = 520 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = -2 Query: 113 GTIWAWKVLYWIWLKPMKLERELRQQGIRGPPYRL 9 G ++AW+VL W+WLKP K+E+ LR+QG++G PYRL Sbjct: 19 GLVYAWRVLNWMWLKPKKIEKLLREQGLQGNPYRL 53 >gb|AFK38261.1| unknown [Medicago truncatula] Length = 76 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = -2 Query: 113 GTIWAWKVLYWIWLKPMKLERELRQQGIRGPPYRL 9 G ++AW+VL W+WLKP K+E+ LR+QG++G PYRL Sbjct: 19 GLVYAWRVLNWMWLKPKKIEKLLREQGLQGNPYRL 53 >dbj|BAL45204.1| cytochrome P450 monooxygenase [Medicago truncatula] Length = 520 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = -2 Query: 113 GTIWAWKVLYWIWLKPMKLERELRQQGIRGPPYRL 9 G ++AW+VL W+WLKP K+E+ LR+QG++G PYRL Sbjct: 19 GLVYAWRVLNWMWLKPKKMEKLLREQGLQGNPYRL 53