BLASTX nr result
ID: Akebia25_contig00047661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00047661 (258 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140719.1| PREDICTED: UPF0631 protein At3g19508-like is... 82 8e-14 ref|XP_004140718.1| PREDICTED: UPF0631 protein At3g19508-like is... 82 8e-14 ref|XP_006422896.1| hypothetical protein CICLE_v10029710mg [Citr... 81 1e-13 ref|XP_002268939.2| PREDICTED: UPF0631 protein At3g19508-like [V... 79 5e-13 emb|CAN67722.1| hypothetical protein VITISV_006021 [Vitis vinifera] 79 5e-13 ref|XP_002527478.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 ref|XP_002313882.1| hypothetical protein POPTR_0009s09720g [Popu... 75 7e-12 gb|EYU37620.1| hypothetical protein MIMGU_mgv1a017241mg [Mimulus... 75 9e-12 ref|XP_007042558.1| UPF0631 protein [Theobroma cacao] gi|5087064... 75 1e-11 ref|XP_007199065.1| hypothetical protein PRUPE_ppa018678mg [Prun... 75 1e-11 ref|XP_002300245.1| hypothetical protein POPTR_0001s30660g [Popu... 75 1e-11 ref|XP_004289749.1| PREDICTED: LYR motif-containing protein At3g... 74 3e-11 ref|XP_006346350.1| PREDICTED: LYR motif-containing protein At3g... 73 5e-11 ref|XP_004230727.1| PREDICTED: LYR motif-containing protein At3g... 73 5e-11 gb|EPS72556.1| hypothetical protein M569_02202, partial [Genlise... 71 2e-10 ref|XP_004511298.1| PREDICTED: LYR motif-containing protein At3g... 71 2e-10 gb|ABK21035.1| unknown [Picea sitchensis] gi|148909487|gb|ABR178... 70 2e-10 gb|ABK20888.1| unknown [Picea sitchensis] 70 2e-10 ref|XP_002885312.1| hypothetical protein ARALYDRAFT_898330 [Arab... 70 3e-10 ref|XP_006298893.1| hypothetical protein CARUB_v10015013mg [Caps... 68 1e-09 >ref|XP_004140719.1| PREDICTED: UPF0631 protein At3g19508-like isoform 2 [Cucumis sativus] Length = 68 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDANDVQS 3 ME+ALR YG +LRLVR LPKDTRPYY+KY+RENFVNYREVDA D +S Sbjct: 1 MEKALRVYGEVLRLVRQLPKDTRPYYAKYVRENFVNYREVDAQDAKS 47 >ref|XP_004140718.1| PREDICTED: UPF0631 protein At3g19508-like isoform 1 [Cucumis sativus] gi|449486613|ref|XP_004157347.1| PREDICTED: UPF0631 protein At3g19508-like [Cucumis sativus] Length = 82 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDANDVQS 3 ME+ALR YG +LRLVR LPKDTRPYY+KY+RENFVNYREVDA D +S Sbjct: 1 MEKALRVYGEVLRLVRQLPKDTRPYYAKYVRENFVNYREVDAQDAKS 47 >ref|XP_006422896.1| hypothetical protein CICLE_v10029710mg [Citrus clementina] gi|568867297|ref|XP_006486975.1| PREDICTED: LYR motif-containing protein At3g19508-like [Citrus sinensis] gi|557524830|gb|ESR36136.1| hypothetical protein CICLE_v10029710mg [Citrus clementina] Length = 82 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDANDVQS 3 M++ALRAY +LRL+R LPKDTRPYY+KY RENFVNYREVDAND S Sbjct: 1 MDKALRAYATVLRLIRRLPKDTRPYYAKYARENFVNYREVDANDASS 47 >ref|XP_002268939.2| PREDICTED: UPF0631 protein At3g19508-like [Vitis vinifera] gi|296083107|emb|CBI22511.3| unnamed protein product [Vitis vinifera] Length = 82 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 M++AL+AYGA+LRLVR LPKDTRPYY+KY RENFVNYREVDA D Sbjct: 1 MKKALKAYGAVLRLVRRLPKDTRPYYAKYARENFVNYREVDAAD 44 >emb|CAN67722.1| hypothetical protein VITISV_006021 [Vitis vinifera] Length = 400 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 M++AL+AYGA+LRLVR LPKDTRPYY+KY RENFVNYREVDA D Sbjct: 23 MKKALKAYGAVLRLVRRLPKDTRPYYAKYARENFVNYREVDAAD 66 >ref|XP_002527478.1| conserved hypothetical protein [Ricinus communis] gi|223533118|gb|EEF34876.1| conserved hypothetical protein [Ricinus communis] Length = 82 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 M++ALR YG +LRLVR LP DTRPYY+KY RENFVNYREVD+ND Sbjct: 1 MQKALRVYGEVLRLVRQLPADTRPYYAKYARENFVNYREVDSND 44 >ref|XP_002313882.1| hypothetical protein POPTR_0009s09720g [Populus trichocarpa] gi|222850290|gb|EEE87837.1| hypothetical protein POPTR_0009s09720g [Populus trichocarpa] Length = 82 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDANDVQ 6 M++AL YG +LRLVR LPKD+RPYY+KY RENFVNYR+V+AND Q Sbjct: 1 MQKALGVYGQVLRLVRRLPKDSRPYYAKYARENFVNYRDVEANDTQ 46 >gb|EYU37620.1| hypothetical protein MIMGU_mgv1a017241mg [Mimulus guttatus] Length = 87 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 149 RNMERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 R M++ LRAYG +LRLVR LP+D+RPYY+KY RENFVNYREVD D Sbjct: 4 REMQKVLRAYGEVLRLVRRLPEDSRPYYAKYARENFVNYREVDPGD 49 >ref|XP_007042558.1| UPF0631 protein [Theobroma cacao] gi|508706493|gb|EOX98389.1| UPF0631 protein [Theobroma cacao] Length = 83 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 ME+ALR Y +LRLVR LPKD+RPYY+KY RENFVNYR+VDA+D Sbjct: 1 MEKALRVYAQVLRLVRRLPKDSRPYYAKYARENFVNYRDVDASD 44 >ref|XP_007199065.1| hypothetical protein PRUPE_ppa018678mg [Prunus persica] gi|462394465|gb|EMJ00264.1| hypothetical protein PRUPE_ppa018678mg [Prunus persica] Length = 82 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDANDVQS 3 ME+ALR Y +LRLVR LP+DTRPYY+KY RENFVNYREV+A D Q+ Sbjct: 1 MEKALRIYAEVLRLVRRLPEDTRPYYAKYARENFVNYREVEAGDDQA 47 >ref|XP_002300245.1| hypothetical protein POPTR_0001s30660g [Populus trichocarpa] gi|222847503|gb|EEE85050.1| hypothetical protein POPTR_0001s30660g [Populus trichocarpa] Length = 82 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDANDVQ 6 M++ALR YG +LRLVR LPKD+RPYY+KY RENFVNYR+V+ +D Q Sbjct: 1 MQKALRVYGQVLRLVRRLPKDSRPYYAKYARENFVNYRDVEVSDTQ 46 >ref|XP_004289749.1| PREDICTED: LYR motif-containing protein At3g19508-like [Fragaria vesca subsp. vesca] Length = 82 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDANDVQS 3 M +ALR Y LRLVR LPKD+RPYY+KYLRENFVNYREV+ ND Q+ Sbjct: 1 MLKALRIYAEALRLVRRLPKDSRPYYAKYLRENFVNYREVEVNDDQA 47 >ref|XP_006346350.1| PREDICTED: LYR motif-containing protein At3g19508-like [Solanum tuberosum] Length = 87 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = -2 Query: 149 RNMERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 + M++A+ AY +LRLVR LPKD+RPYY+KY RENFVNYRE+D+ND Sbjct: 4 QEMQKAIGAYREVLRLVRRLPKDSRPYYAKYARENFVNYREIDSND 49 >ref|XP_004230727.1| PREDICTED: LYR motif-containing protein At3g19508-like isoform 1 [Solanum lycopersicum] gi|460369766|ref|XP_004230728.1| PREDICTED: LYR motif-containing protein At3g19508-like isoform 2 [Solanum lycopersicum] Length = 87 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = -2 Query: 149 RNMERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 + M++A+ AY +LRLVR LPKD+RPYY+KY RENFVNYRE+D+ND Sbjct: 4 QEMQKAIGAYREVLRLVRRLPKDSRPYYAKYARENFVNYREIDSND 49 >gb|EPS72556.1| hypothetical protein M569_02202, partial [Genlisea aurea] Length = 80 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDANDVQ 6 M +ALRAYG +LRLVR LPKD+R YY+KY RENFVNYR+V+ +DV+ Sbjct: 2 MRKALRAYGEVLRLVRLLPKDSRGYYAKYARENFVNYRDVEPDDVE 47 >ref|XP_004511298.1| PREDICTED: LYR motif-containing protein At3g19508-like [Cicer arietinum] Length = 82 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 ME+A+RAY +LRLVR LPKD+R YY+KY RENFVNYREVD +D Sbjct: 1 MEKAVRAYAEVLRLVRRLPKDSRGYYAKYARENFVNYREVDPSD 44 >gb|ABK21035.1| unknown [Picea sitchensis] gi|148909487|gb|ABR17841.1| unknown [Picea sitchensis] Length = 81 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 MER+LRAYG +LRL+R LPK TR YY KY RENFVNYREV +D Sbjct: 1 MERSLRAYGGILRLIRLLPKQTRSYYQKYARENFVNYREVSGSD 44 >gb|ABK20888.1| unknown [Picea sitchensis] Length = 64 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 MER+LRAYG +LRL+R LPK TR YY KY RENFVNYREV +D Sbjct: 1 MERSLRAYGGILRLIRLLPKQTRSYYQKYARENFVNYREVSGSD 44 >ref|XP_002885312.1| hypothetical protein ARALYDRAFT_898330 [Arabidopsis lyrata subsp. lyrata] gi|297331152|gb|EFH61571.1| hypothetical protein ARALYDRAFT_898330 [Arabidopsis lyrata subsp. lyrata] Length = 81 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 M++ LR YG +LRLVR LP DTRPYY+KY RENFVNYREVD ++ Sbjct: 1 MKKVLRVYGGVLRLVRLLPADTRPYYAKYARENFVNYREVDQSE 44 >ref|XP_006298893.1| hypothetical protein CARUB_v10015013mg [Capsella rubella] gi|482567602|gb|EOA31791.1| hypothetical protein CARUB_v10015013mg [Capsella rubella] Length = 83 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -2 Query: 143 MERALRAYGAMLRLVRHLPKDTRPYYSKYLRENFVNYREVDAND 12 M++ L YG +LRLVR LP DTRPYY+KY RENFVNYREVD ++ Sbjct: 3 MKKVLSVYGGVLRLVRLLPADTRPYYAKYARENFVNYREVDQSE 46